Human IER3IP1/HSPC039/MEDS ORF/cDNA clone-Lentivirus particle (NM_016097)

Cat. No.: vGMLP004599

Pre-made Human IER3IP1/HSPC039/MEDS Lentiviral expression plasmid for IER3IP1 lentivirus packaging, IER3IP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IER3IP1/HSPC039 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004599 Human IER3IP1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004599
Gene Name IER3IP1
Accession Number NM_016097
Gene ID 51124
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 249 bp
Gene Alias HSPC039,MEDS,PRO2309
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCTTTACCCTGTACTCACTGCTGCAGGCAGCCCTGCTCTGCGTCAACGCCATCGCAGTGCTGCACGAGGAGCGATTCCTCAAGAACATTGGCTGGGGAACAGACCAGGGAATTGGTGGATTTGGAGAAGAGCCGGGAATTAAATCACAGCTAATGAACCTTATTCGATCTGTAAGAACCGTGATGAGAGTGCCATTGATAATAGTAAACTCAATTGCAATTGTGTTACTTTTATTATTTGGATGA
ORF Protein Sequence MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNSIAIVLLLLFG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0996-Ab Anti-IER3IP1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0996-Ag IER3IP1 protein
    ORF Viral Vector pGMLP004599 Human IER3IP1 Lentivirus plasmid
    ORF Viral Vector vGMLP004599 Human IER3IP1 Lentivirus particle


    Target information

    Target ID GM-IP0996
    Target Name IER3IP1
    Gene ID 51124, 66191, 106994495, 127566412, 101086429, 612379, 768079, 102150767
    Gene Symbol and Synonyms 1110057H19Rik,HSPC039,IER3IP1,MEDS,PRO2309
    Uniprot Accession Q9Y5U9
    Uniprot Entry Name IR3IP_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000134049
    Target Classification Not Available

    This gene encodes a small protein that is localized to the endoplasmic reticulum (ER) and may play a role in the ER stress response by mediating cell differentiation and apoptosis. Transcription of this gene is regulated by tumor necrosis factor alpha and specificity protein 1 (Sp1). Mutations in this gene may play a role in microcephaly, epilepsy, and diabetes syndrome (MEDS), and a pseudogene of this gene is located on the long arm of chromosome 12. [provided by RefSeq, Dec 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.