Human IER3IP1/HSPC039/MEDS ORF/cDNA clone-Lentivirus particle (NM_016097)
Cat. No.: vGMLP004599
Pre-made Human IER3IP1/HSPC039/MEDS Lentiviral expression plasmid for IER3IP1 lentivirus packaging, IER3IP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
IER3IP1/HSPC039 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004599 | Human IER3IP1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004599 |
| Gene Name | IER3IP1 |
| Accession Number | NM_016097 |
| Gene ID | 51124 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 249 bp |
| Gene Alias | HSPC039,MEDS,PRO2309 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCTTTACCCTGTACTCACTGCTGCAGGCAGCCCTGCTCTGCGTCAACGCCATCGCAGTGCTGCACGAGGAGCGATTCCTCAAGAACATTGGCTGGGGAACAGACCAGGGAATTGGTGGATTTGGAGAAGAGCCGGGAATTAAATCACAGCTAATGAACCTTATTCGATCTGTAAGAACCGTGATGAGAGTGCCATTGATAATAGTAAACTCAATTGCAATTGTGTTACTTTTATTATTTGGATGA |
| ORF Protein Sequence | MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNSIAIVLLLLFG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0996-Ab | Anti-IER3IP1 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0996-Ag | IER3IP1 protein |
| ORF Viral Vector | pGMLP004599 | Human IER3IP1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004599 | Human IER3IP1 Lentivirus particle |
Target information
| Target ID | GM-IP0996 |
| Target Name | IER3IP1 |
| Gene ID | 51124, 66191, 106994495, 127566412, 101086429, 612379, 768079, 102150767 |
| Gene Symbol and Synonyms | 1110057H19Rik,HSPC039,IER3IP1,MEDS,PRO2309 |
| Uniprot Accession | Q9Y5U9 |
| Uniprot Entry Name | IR3IP_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000134049 |
| Target Classification | Not Available |
This gene encodes a small protein that is localized to the endoplasmic reticulum (ER) and may play a role in the ER stress response by mediating cell differentiation and apoptosis. Transcription of this gene is regulated by tumor necrosis factor alpha and specificity protein 1 (Sp1). Mutations in this gene may play a role in microcephaly, epilepsy, and diabetes syndrome (MEDS), and a pseudogene of this gene is located on the long arm of chromosome 12. [provided by RefSeq, Dec 2011]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


