Human P12/p12/POLDS ORF/cDNA clone-Lentivirus particle (NM_021173)

Cat. No.: vGMLP004728

Pre-made Human P12/p12/POLDS Lentiviral expression plasmid for P12 lentivirus packaging, P12 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to POLD4/P12/p12 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004728 Human P12 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004728
Gene Name P12
Accession Number NM_021173
Gene ID 57804
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 324 bp
Gene Alias p12,POLDS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCCGGAAGCGGCTCATCACTGATTCCTACCCGGTTGTGAAGAGGAGGGAGGGGCCCGCTGGGCACAGCAAGGGGGAGCTGGCACCCGAGCTAGGGGAGGAGCCCCAGCCCCGCGACGAGGAGGAAGCGGAGCTGGAGCTGCTGAGGCAGTTTGACCTGGCCTGGCAGTACGGGCCCTGCACCGGGATCACACGGCTGCAGCGCTGGTGTCGGGCCAAGCAGATGGGCTTGGAGCCTCCCCCAGAGGTGTGGCAGGTGCTGAAGACCCACCCCGGAGACCCCCGCTTCCAGTGCAGTCTCTGGCATCTCTATCCCCTATGA
ORF Protein Sequence MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA187-Ab Anti-POLD4 monoclonal antibody
    Target Antigen GM-Tg-g-TA187-Ag POLD4 protein
    ORF Viral Vector pGMLP004728 Human P12 Lentivirus plasmid
    ORF Viral Vector vGMLP004728 Human P12 Lentivirus particle


    Target information

    Target ID GM-TA187
    Target Name POLD4
    Gene ID 57804, 69745, 712632, 361698, 101091308, 119869080, 617899, 100059111
    Gene Symbol and Synonyms 2410012M21Rik,p12,POLD4,POLDS
    Uniprot Accession Q9HCU8
    Uniprot Entry Name DPOD4_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease IgA glomerulonephritis
    Gene Ensembl ENSG00000175482
    Target Classification Not Available

    This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA polymerase delta and plays a role in fork repair and stabilization through interactions with the DNA helicase Bloom syndrome protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.