Human P12/p12/POLDS ORF/cDNA clone-Lentivirus particle (NM_021173)
Cat. No.: vGMLP004728
Pre-made Human P12/p12/POLDS Lentiviral expression plasmid for P12 lentivirus packaging, P12 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
POLD4/P12/p12 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004728 | Human P12 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004728 |
| Gene Name | P12 |
| Accession Number | NM_021173 |
| Gene ID | 57804 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 324 bp |
| Gene Alias | p12,POLDS |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGGCCGGAAGCGGCTCATCACTGATTCCTACCCGGTTGTGAAGAGGAGGGAGGGGCCCGCTGGGCACAGCAAGGGGGAGCTGGCACCCGAGCTAGGGGAGGAGCCCCAGCCCCGCGACGAGGAGGAAGCGGAGCTGGAGCTGCTGAGGCAGTTTGACCTGGCCTGGCAGTACGGGCCCTGCACCGGGATCACACGGCTGCAGCGCTGGTGTCGGGCCAAGCAGATGGGCTTGGAGCCTCCCCCAGAGGTGTGGCAGGTGCTGAAGACCCACCCCGGAGACCCCCGCTTCCAGTGCAGTCTCTGGCATCTCTATCCCCTATGA |
| ORF Protein Sequence | MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-TA187-Ab | Anti-POLD4 monoclonal antibody |
| Target Antigen | GM-Tg-g-TA187-Ag | POLD4 protein |
| ORF Viral Vector | pGMLP004728 | Human P12 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004728 | Human P12 Lentivirus particle |
Target information
| Target ID | GM-TA187 |
| Target Name | POLD4 |
| Gene ID | 57804, 69745, 712632, 361698, 101091308, 119869080, 617899, 100059111 |
| Gene Symbol and Synonyms | 2410012M21Rik,p12,POLD4,POLDS |
| Uniprot Accession | Q9HCU8 |
| Uniprot Entry Name | DPOD4_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | IgA glomerulonephritis |
| Gene Ensembl | ENSG00000175482 |
| Target Classification | Not Available |
This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA polymerase delta and plays a role in fork repair and stabilization through interactions with the DNA helicase Bloom syndrome protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


