Human DCD/AIDD/DCD-1 ORF/cDNA clone-Lentivirus particle (NM_001300854)
Cat. No.: vGMLP004746
Pre-made Human DCD/AIDD/DCD-1 Lentiviral expression plasmid for DCD lentivirus packaging, DCD lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
DCD/AIDD products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004746 | Human DCD Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004746 |
| Gene Name | DCD |
| Accession Number | NM_001300854 |
| Gene ID | 117159 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 366 bp |
| Gene Alias | AIDD,DCD-1,DSEP,HCAP,PIF |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGGTTCATGACTCTCCTCTTCCTGACAGCTCTGGCAGGAGCCCTGGTCTGTGCCTATGATCCAGAGGCCGCCTCTGCCCCAGGATCGGGGAACCCTTGCCATGAAGCATCAGCAGCTCAAAAGGAAAATGCAGGTGAAGACCCAGGGTTAGCCAGACAGGCACCAAAGCCAAGGAAGCAGAGATCCAGCCTTCTGGAAAAAGGCCTAGACGGAGCAAAAAAAGCTGTGGGGGGACTCGGAAAACTAGGAAAAGATGCAGTCGAAGATCTAGAAAGCGTGGGTAAAGGTGGGGAAGAGAGGTTGGTCTTTGGGGCTCCTGTGAATCTAACCTCCATCCCTCTGACTTCTGTGAGCCGTCCATGA |
| ORF Protein Sequence | MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGGEERLVFGAPVNLTSIPLTSVSRP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0848-Ab | Anti-DCD/ AIDD-1/ DSEP functional antibody |
| Target Antigen | GM-Tg-g-SE0848-Ag | DCD protein |
| ORF Viral Vector | pGMLP004746 | Human DCD Lentivirus plasmid |
| ORF Viral Vector | vGMLP004746 | Human DCD Lentivirus particle |
Target information
| Target ID | GM-SE0848 |
| Target Name | DCD |
| Gene ID | 117159, 704163 |
| Gene Symbol and Synonyms | AIDD,DCD,DCD-1,DSEP,HCAP,PIF |
| Uniprot Accession | P81605 |
| Uniprot Entry Name | DCD_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000161634 |
| Target Classification | Not Available |
This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


