Human SBSPON/C8orf84/RPESP ORF/cDNA clone-Lentivirus particle (NM_153225)

Cat. No.: vGMLP004793

Pre-made Human SBSPON/C8orf84/RPESP Lentiviral expression plasmid for SBSPON lentivirus packaging, SBSPON lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SBSPON/C8orf84 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004793 Human SBSPON Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004793
Gene Name SBSPON
Accession Number NM_153225
Gene ID 157869
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 795 bp
Gene Alias C8orf84,RPESP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGACCCTGTGGATGGCGCTGTGCGCGCTGTCGCGGCTGTGGCCCGGGGCCCAGGCCGGCTGCGCCGAGGCCGGGCGCTGCTGTCCCGGCCGGGACCCCGCCTGCTTCGCCCGCGGCTGGAGGCTGGACAGGGTCTACGGGACGTGTTTCTGCGACCAAGCCTGTCGCTTCACCGGGGACTGCTGCTTCGACTACGACAGGGCGTGCCCAGCTCGCCCGTGCTTCGTGGGGGAATGGAGCCCCTGGAGTGGTTGTGCAGACCAGTGCAAGCCTACAACCCGTGTGCGGAGGCGCTCGGTGCAGCAGGAGCCTCAGAACGGCGGGGCGCCCTGCCCACCCCTGGAAGAGAGAGCTGGCTGCCTGGAGTACTCCACCCCGCAGGGCCAGGACTGCGGGCACACCTATGTTCCTGCCTTTATAACTACCTCTGCATTCAACAAGGAGAGAACACGACAAGCTACGTCTCCACACTGGTCTACACACACAGAGGATGCTGGATACTGTATGGAGTTTAAGACAGAGTCCTTGACTCCTCACTGTGCTCTGGAAAACTGGCCCTTGACTAGATGGATGCAGTATCTCCGAGAGGGATACACGGTGTGTGTGGATTGTCAGCCTCCAGCTATGAACTCTGTGAGCCTTCGTTGTTCTGGAGATGGCCTGGACTCCGATGGAAATCAGACTCTCCATTGGCAAGCAATTGGTAATCCTCGGTGTCAAGGAACTTGGAAAAAAGTTCGGCGAGTAGACCAGTGTTCTTGTCCAGCTGTTCACAGTTTTATTTTTATATAG
ORF Protein Sequence MRTLWMALCALSRLWPGAQAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRFTGDCCFDYDRACPARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAGCLEYSTPQGQDCGHTYVPAFITTSAFNKERTRQATSPHWSTHTEDAGYCMEFKTESLTPHCALENWPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1261-Ab Anti-SBSPO/ SBSPON/ C8orf84 functional antibody
    Target Antigen GM-Tg-g-SE1261-Ag SBSPON protein
    ORF Viral Vector pGMLP004793 Human SBSPON Lentivirus plasmid
    ORF Viral Vector vGMLP004793 Human SBSPON Lentivirus particle


    Target information

    Target ID GM-SE1261
    Target Name SBSPON
    Gene ID 157869, 226866, 697412, 297757, 101099429, 610426, 525332, 100061205
    Gene Symbol and Synonyms C14H8orf84,C29H8orf84,C8orf84,Gm106,RGD1559717,RPESP,SBSPON
    Uniprot Accession Q8IVN8
    Uniprot Entry Name SBSPO_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000164764
    Target Classification Not Available

    Predicted to be an extracellular matrix structural constituent. Colocalizes with collagen-containing extracellular matrix. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.