Human TMEM37/PR/PR1 ORF/cDNA clone-Lentivirus particle (NM_183240)

Cat. No.: vGMLP004894

Pre-made Human TMEM37/PR/PR1 Lentiviral expression plasmid for TMEM37 lentivirus packaging, TMEM37 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TMEM37/PR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004894 Human TMEM37 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004894
Gene Name TMEM37
Accession Number NM_183240
Gene ID 140738
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 573 bp
Gene Alias PR,PR1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTGCCGTCGGCGTGCAGGCCCAGAGGCCTTTGGGCCAAAGGCAGCCCCGCCGGTCCTTCTTTGAATCCTTCATCCGGACCCTCATCATCACGTGTGTGGCCCTGGCTGTGGTCCTGTCCTCGGTCTCCATTTGTGATGGGCACTGGCTCCTGGCTGAGGACCGCCTCTTCGGGCTCTGGCACTTCTGCACCACCACCAACCAGACGATCTGCTTCAGAGACCTGGGCCAGGCCCATGTGCCCGGGCTGGCCGTGGGCATGGGCCTGGTACGCAGCGTGGGCGCCTTGGCCGTGGTGGCCGCCATTTTTGGCCTGGAGTTCCTCATGGTGTCCCAGTTGTGCGAGGACAAACACTCACAGTGCAAGTGGGTCATGGGTTCCATCCTCCTCCTGGTGTCTTTCGTCCTCTCCTCCGGCGGGCTCCTGGGTTTTGTGATCCTCCTCAGGAACCAAGTCACACTCATCGGCTTCACCCTAATGTTTTGGTGCGAATTCACTGCCTCCTTCCTCCTCTTCCTGAACGCCATCAGCGGCCTTCACATCAACAGCATCACCCATCCCTGGGAATGA
ORF Protein Sequence MTAVGVQAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFGLWHFCTTTNQTICFRDLGQAHVPGLAVGMGLVRSVGALAVVAAIFGLEFLMVSQLCEDKHSQCKWVMGSILLLVSFVLSSGGLLGFVILLRNQVTLIGFTLMFWCEFTASFLLFLNAISGLHINSITHPWE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2095-Ab Anti-TMEM37 monoclonal antibody
    Target Antigen GM-Tg-g-IP2095-Ag TMEM37 protein
    ORF Viral Vector pGMLP004894 Human TMEM37 Lentivirus plasmid
    ORF Viral Vector vGMLP004894 Human TMEM37 Lentivirus particle


    Target information

    Target ID GM-IP2095
    Target Name TMEM37
    Gene ID 140738, 170706, 695060, 245953, 101085394, 610386, 613815, 102148293
    Gene Symbol and Synonyms PR,PR1,TMEM37
    Uniprot Accession Q8WXS4
    Uniprot Entry Name CCGL_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000171227
    Target Classification Not Available

    Predicted to enable calcium channel activity and voltage-gated ion channel activity. Predicted to be involved in calcium ion transmembrane transport and regulation of ion transmembrane transport. Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.