Human CNPY3/CAG4A/EIEE60 ORF/cDNA clone-Lentivirus particle (NM_001318842)
Cat. No.: vGMLP004908
Pre-made Human CNPY3/CAG4A/EIEE60 Lentiviral expression plasmid for CNPY3 lentivirus packaging, CNPY3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CNPY3/CAG4A products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP004908 | Human CNPY3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP004908 |
Gene Name | CNPY3 |
Accession Number | NM_001318842 |
Gene ID | 10695 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 936 bp |
Gene Alias | CAG4A,EIEE60,ERDA5,PRAT4A,TNRC5 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGATTCAATGCCTGAGCCCGCGTCCCGCTGTCTTCTGCTTCTTCCCTTGCTGCTGCTGCTGCTGCTGCTGCTGCCGGCCCCGGAGCTGGGCCCGAGCCAGGCCGGAGCTGAGGAGAACGACTGGGTTCGCCTGCCCAGCAAATGCGAAGTGTGTAAATATGTTGCTGTGGAGCTGAAGTCAGCCTTTGAGGAAACCGGCAAGACCAAGGAGGTGATTGGCACGGGCTATGGCATCCTGGACCAGAAGGCCTCTGGAGTCAAATACACCAAGTCCATTTCAGATCCCCCAGACCAGATGACCTATCTTCCTTCCAGCTCTGAGTCACTTCCCATTGGAGGGGAACTCAGTTCCTCATCCTCCTGTCTTGGCAGGGACTTGCGGTTAATCGAAGTCACTGAGACCATTTGCAAGAGGCTCCTGGATTATAGCCTGCACAAGGAGAGGACCGGCAGCAATCGATTTGCCAAGGGCATGTCAGAGACCTTTGAGACATTACACAACCTGGTACACAAAGGGGTCAAGGTGGTGATGGACATCCCCTATGAGCTGTGGAACGAGACTTCTGCAGAGGTGGCTGACCTCAAGAAGCAGTGTGATGTGCTGGTGGAAGAGTTTGAGGAGGTGATCGAGGACTGGTACAGGAACCACCAGGAGGAAGACCTGACTGAATTCCTCTGCGCCAACCACGTGCTGAAGGGAAAAGACACCAGTTGCCTGGCAGAGCAGTGGTCCGGCAAGAAGGGAGACACAGCTGCCCTGGGAGGGAAGAAGTCCAAGAAGAAGAGCAGCAGGGCCAAGGCAGCAGGCGGCAGGAGTAGCAGCAGCAAACAAAGGAAGGAGCTGGGTGGCCTTGAGGGAGACCCCAGCCCCGAGGAGGATGAGGGCATCCAGAAGGCATCCCCTCTCACACACAGCCCCCCTGATGAGCTCTGA |
ORF Protein Sequence | MDSMPEPASRCLLLLPLLLLLLLLLPAPELGPSQAGAEENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSISDPPDQMTYLPSSSESLPIGGELSSSSSCLGRDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGIQKASPLTHSPPDEL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE1507-Ab | Anti-CNPY3/ CAG4A/ EIEE60 functional antibody |
Target Antigen | GM-Tg-g-SE1507-Ag | CNPY3 protein |
ORF Viral Vector | pGMLP004908 | Human CNPY3 Lentivirus plasmid |
ORF Viral Vector | pGMLV002449 | Human CNPY3 Lentivirus plasmid |
ORF Viral Vector | vGMLP004908 | Human CNPY3 Lentivirus particle |
ORF Viral Vector | vGMLV002449 | Human CNPY3 Lentivirus particle |
Target information
Target ID | GM-SE1507 |
Target Name | CNPY3 |
Gene ID | 10695, 72029, 100424676, 685174, 101082750, 609385, 510220, 100067096 |
Gene Symbol and Synonyms | 1600025D17Rik,2410050O22Rik,CAG4A,CNPY3,DEE60,EIEE60,ERDA5,PRAT4A,TNRC5 |
Uniprot Accession | Q9BT09 |
Uniprot Entry Name | CNPY3_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000137161 |
Target Classification | Not Available |
This gene encodes a protein that binds members of the toll-like receptor protein family and functions as a chaperone to aid in folding and export of these proteins. Alternative splicing results in multiple transcript variants. Naturally occuring readthrough transcription occurs between this locus and the downstream GNMT (glycine N-methyltransferase) gene and is represented with GeneID:107080644. [provided by RefSeq, Jan 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.