Human GUCA2B/GCAP-II/UGN ORF/cDNA clone-Lentivirus particle (NM_007102)
Cat. No.: vGMLP005002
Pre-made Human GUCA2B/GCAP-II/UGN Lentiviral expression plasmid for GUCA2B lentivirus packaging, GUCA2B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
GUCA2B/GCAP-II products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP005002 | Human GUCA2B Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP005002 |
| Gene Name | GUCA2B |
| Accession Number | NM_007102 |
| Gene ID | 2981 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 339 bp |
| Gene Alias | GCAP-II,UGN |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGGCTGCAGGGCTGCATCAGGGCTCCTGCCAGGAGTGGCCGTGGTCCTCCTGCTGCTGCTGCAGAGCACACAGTCAGTCTACATCCAGTACCAAGGCTTCCGGGTCCAGCTGGAATCCATGAAGAAGCTGAGTGACCTGGAGGCACAGTGGGCACCCAGCCCCCGCCTGCAGGCCCAGAGCCTCCTGCCCGCCGTGTGCCACCACCCTGCTCTGCCTCAGGACCTTCAGCCTGTCTGCGCCTCGCAGGAGGCTTCCAGCATCTTCAAGACCCTGAGGACCATCGCTAACGACGACTGTGAGCTGTGTGTGAACGTTGCGTGTACCGGCTGCCTCTGA |
| ORF Protein Sequence | MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0250-Ab | Anti-GUC2B/ GUCA2B/ GCAP-II functional antibody |
| Target Antigen | GM-Tg-g-SE0250-Ag | GUCA2B protein |
| ORF Viral Vector | pGMLP005002 | Human GUCA2B Lentivirus plasmid |
| ORF Viral Vector | vGMLP005002 | Human GUCA2B Lentivirus particle |
Target information
| Target ID | GM-SE0250 |
| Target Name | GUCA2B |
| Gene ID | 2981, 14916, 699525, 64055, 101092381, 100684829, 515664, 100067585 |
| Gene Symbol and Synonyms | GCAP-II,Gcap2,GUCA2B,UGN |
| Uniprot Accession | Q16661 |
| Uniprot Entry Name | GUC2B_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Malignant neoplasm of bladder |
| Gene Ensembl | ENSG00000044012 |
| Target Classification | Not Available |
This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this peptide to its cognate receptor stimulates an increase in cyclic GMP and may regulate salt and water homeostasis in the intestine and kidneys. [provided by RefSeq, Nov 2015]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


