Human RNF122 ORF/cDNA clone-Lentivirus particle (NM_024787)
Cat. No.: vGMLP005019
Pre-made Human RNF122/ Lentiviral expression plasmid for RNF122 lentivirus packaging, RNF122 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
RNF122/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP005019 | Human RNF122 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP005019 |
Gene Name | RNF122 |
Accession Number | NM_024787 |
Gene ID | 79845 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 468 bp |
Gene Alias | |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCACCCATTCCAGTGGTGTAACGGGTGTTTCTGTGGCCTGGGACTGGTTAGCACCAACAAGTCCTGCTCGATGCCACCCATCAGTTTCCAGGACCTTCCGCTCAACATCTATATGGTCATCTTCGGCACAGGCATCTTTGTCTTCATGCTCAGCCTTATCTTCTGCTGCTATTTTATCAGCAAACTGCGGAACCAGGCACAGAGTGAGCGATACGGATATAAGGAGGTGGTGCTTAAAGGTGATGCCAAGAAGTTACAATTATATGGGCAGACCTGCGCAGTCTGTCTGGAAGACTTCAAGGGGAAGGATGAGTTAGGCGTGCTCCCGTGCCAACACGCCTTTCACCGCAAGTGTCTGGTGAAATGGCTGGAAGTTCGCTGTGTCTGCCCCATGTGTAACAAGCCCATTGCTAGTCCCTCAGAGGCCACGCAGAACATTGGGATTCTATTGGATGAGCTGGTGTGA |
ORF Protein Sequence | MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1503-Ab | Anti-RNF122 monoclonal antibody |
Target Antigen | GM-Tg-g-IP1503-Ag | RNF122 protein |
ORF Viral Vector | pGMLP005019 | Human RNF122 Lentivirus plasmid |
ORF Viral Vector | vGMLP005019 | Human RNF122 Lentivirus particle |
Target information
Target ID | GM-IP1503 |
Target Name | RNF122 |
Gene ID | 79845, 68867, 697013, 502091, 101090607, 608382, 510037, 100060999 |
Gene Symbol and Synonyms | 1110063C11Rik,RGD1561238,RNF122 |
Uniprot Accession | Q9H9V4 |
Uniprot Entry Name | RN122_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000133874 |
Target Classification | Not Available |
The encoded protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The encoded protein is localized to the endoplasmic reticulum and golgi apparatus, and may be associated with cell viability. [provided by RefSeq, Jul 2013]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.