Human RNF122 ORF/cDNA clone-Lentivirus particle (NM_024787)

Cat. No.: vGMLP005019

Pre-made Human RNF122/ Lentiviral expression plasmid for RNF122 lentivirus packaging, RNF122 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RNF122/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005019 Human RNF122 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005019
Gene Name RNF122
Accession Number NM_024787
Gene ID 79845
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 468 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCACCCATTCCAGTGGTGTAACGGGTGTTTCTGTGGCCTGGGACTGGTTAGCACCAACAAGTCCTGCTCGATGCCACCCATCAGTTTCCAGGACCTTCCGCTCAACATCTATATGGTCATCTTCGGCACAGGCATCTTTGTCTTCATGCTCAGCCTTATCTTCTGCTGCTATTTTATCAGCAAACTGCGGAACCAGGCACAGAGTGAGCGATACGGATATAAGGAGGTGGTGCTTAAAGGTGATGCCAAGAAGTTACAATTATATGGGCAGACCTGCGCAGTCTGTCTGGAAGACTTCAAGGGGAAGGATGAGTTAGGCGTGCTCCCGTGCCAACACGCCTTTCACCGCAAGTGTCTGGTGAAATGGCTGGAAGTTCGCTGTGTCTGCCCCATGTGTAACAAGCCCATTGCTAGTCCCTCAGAGGCCACGCAGAACATTGGGATTCTATTGGATGAGCTGGTGTGA
ORF Protein Sequence MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1503-Ab Anti-RNF122 monoclonal antibody
    Target Antigen GM-Tg-g-IP1503-Ag RNF122 protein
    ORF Viral Vector pGMLP005019 Human RNF122 Lentivirus plasmid
    ORF Viral Vector vGMLP005019 Human RNF122 Lentivirus particle


    Target information

    Target ID GM-IP1503
    Target Name RNF122
    Gene ID 79845, 68867, 697013, 502091, 101090607, 608382, 510037, 100060999
    Gene Symbol and Synonyms 1110063C11Rik,RGD1561238,RNF122
    Uniprot Accession Q9H9V4
    Uniprot Entry Name RN122_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000133874
    Target Classification Not Available

    The encoded protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The encoded protein is localized to the endoplasmic reticulum and golgi apparatus, and may be associated with cell viability. [provided by RefSeq, Jul 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.