Human PSMB7/Z ORF/cDNA clone-Lentivirus particle (NM_002799)
Cat. No.: vGMLP005036
Pre-made Human PSMB7/Z Lentiviral expression plasmid for PSMB7 lentivirus packaging, PSMB7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PS beta-2/PSMB7/Z products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP005036 | Human PSMB7 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP005036 |
| Gene Name | PSMB7 |
| Accession Number | NM_002799 |
| Gene ID | 5695 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 834 bp |
| Gene Alias | Z |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGGCTGTGTCGGTGTATGCTCCACCAGTTGGAGGCTTCTCTTTTGATAACTGCCGCAGGAATGCCGTCTTGGAAGCCGATTTTGCAAAGAGGGGATACAAGCTTCCAAAGGTCCGGAAAACTGGCACGACCATCGCTGGGGTGGTCTATAAGGATGGCATAGTTCTTGGAGCAGATACAAGAGCAACTGAAGGGATGGTTGTTGCTGACAAGAACTGTTCAAAAATACACTTCATATCTCCTAATATTTATTGTTGTGGTGCTGGGACAGCTGCAGACACAGACATGACAACCCAGCTCATTTCTTCCAACCTGGAGCTCCACTCCCTCTCCACTGGCCGTCTTCCCAGAGTTGTGACAGCCAATCGGATGCTGAAGCAGATGCTTTTCAGGTATCAAGGTTACATTGGTGCAGCCCTAGTTTTAGGGGGAGTAGATGTTACTGGACCTCACCTCTACAGCATCTATCCTCATGGATCAACTGATAAGTTGCCTTATGTCACCATGGGTTCTGGCTCCTTGGCAGCAATGGCTGTATTTGAAGATAAGTTTAGGCCAGACATGGAGGAGGAGGAAGCCAAGAATCTGGTGAGCGAAGCCATCGCAGCTGGCATCTTCAACGACCTGGGCTCCGGAAGCAACATTGACCTCTGCGTCATCAGCAAGAACAAGCTGGATTTTCTCCGCCCATACACAGTGCCCAACAAGAAGGGGACCAGGCTTGGCCGGTACAGGTGTGAGAAAGGGACTACTGCAGTCCTCACTGAGAAAATCACTCCTCTGGAGATTGAGGTGCTGGAAGAAACAGTCCAAACAATGGACACTTCCTGA |
| ORF Protein Sequence | MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T55986-Ab | Anti-PS beta-2 monoclonal antibody |
| Target Antigen | GM-Tg-g-T55986-Ag | PS beta-2/PSMB7 protein |
| ORF Viral Vector | pGMLP005036 | Human PSMB7 Lentivirus plasmid |
| ORF Viral Vector | vGMLP005036 | Human PSMB7 Lentivirus particle |
Target information
| Target ID | GM-T55986 |
| Target Name | PS beta-2 |
| Gene ID | 5695, 19177, 694567, 85492, 101081009, 100686423, 511207, 100067317 |
| Gene Symbol and Synonyms | MC14,PSMB7 |
| Uniprot Accession | Q99436 |
| Uniprot Entry Name | PSB7_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000136930 |
| Target Classification | Not Available |
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. The encoded protein is a member of the proteasome B-type family, also known as the T1B family, and is a 20S core beta subunit in the proteasome. Expression of this catalytic subunit is downregulated by gamma interferon, and proteolytic processing is required to generate a mature subunit. A pseudogene of this gene is located on the long arm of chromosome 14. [provided by RefSeq, Jul 2012]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


