Human PSMB7/Z ORF/cDNA clone-Lentivirus particle (NM_002799)

Cat. No.: vGMLP005036

Pre-made Human PSMB7/Z Lentiviral expression plasmid for PSMB7 lentivirus packaging, PSMB7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PS beta-2/PSMB7/Z products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005036 Human PSMB7 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005036
Gene Name PSMB7
Accession Number NM_002799
Gene ID 5695
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 834 bp
Gene Alias Z
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCTGTGTCGGTGTATGCTCCACCAGTTGGAGGCTTCTCTTTTGATAACTGCCGCAGGAATGCCGTCTTGGAAGCCGATTTTGCAAAGAGGGGATACAAGCTTCCAAAGGTCCGGAAAACTGGCACGACCATCGCTGGGGTGGTCTATAAGGATGGCATAGTTCTTGGAGCAGATACAAGAGCAACTGAAGGGATGGTTGTTGCTGACAAGAACTGTTCAAAAATACACTTCATATCTCCTAATATTTATTGTTGTGGTGCTGGGACAGCTGCAGACACAGACATGACAACCCAGCTCATTTCTTCCAACCTGGAGCTCCACTCCCTCTCCACTGGCCGTCTTCCCAGAGTTGTGACAGCCAATCGGATGCTGAAGCAGATGCTTTTCAGGTATCAAGGTTACATTGGTGCAGCCCTAGTTTTAGGGGGAGTAGATGTTACTGGACCTCACCTCTACAGCATCTATCCTCATGGATCAACTGATAAGTTGCCTTATGTCACCATGGGTTCTGGCTCCTTGGCAGCAATGGCTGTATTTGAAGATAAGTTTAGGCCAGACATGGAGGAGGAGGAAGCCAAGAATCTGGTGAGCGAAGCCATCGCAGCTGGCATCTTCAACGACCTGGGCTCCGGAAGCAACATTGACCTCTGCGTCATCAGCAAGAACAAGCTGGATTTTCTCCGCCCATACACAGTGCCCAACAAGAAGGGGACCAGGCTTGGCCGGTACAGGTGTGAGAAAGGGACTACTGCAGTCCTCACTGAGAAAATCACTCCTCTGGAGATTGAGGTGCTGGAAGAAACAGTCCAAACAATGGACACTTCCTGA
ORF Protein Sequence MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T55986-Ab Anti-PS beta-2 monoclonal antibody
    Target Antigen GM-Tg-g-T55986-Ag PS beta-2/PSMB7 protein
    ORF Viral Vector pGMLP005036 Human PSMB7 Lentivirus plasmid
    ORF Viral Vector vGMLP005036 Human PSMB7 Lentivirus particle


    Target information

    Target ID GM-T55986
    Target Name PS beta-2
    Gene ID 5695, 19177, 694567, 85492, 101081009, 100686423, 511207, 100067317
    Gene Symbol and Synonyms MC14,PSMB7
    Uniprot Accession Q99436
    Uniprot Entry Name PSB7_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000136930
    Target Classification Not Available

    The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. The encoded protein is a member of the proteasome B-type family, also known as the T1B family, and is a 20S core beta subunit in the proteasome. Expression of this catalytic subunit is downregulated by gamma interferon, and proteolytic processing is required to generate a mature subunit. A pseudogene of this gene is located on the long arm of chromosome 14. [provided by RefSeq, Jul 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.