Human C1QL3/C1ql/C1QTNF13 ORF/cDNA clone-Lentivirus particle (NM_001010908)

Cat. No.: vGMLP005146

Pre-made Human C1QL3/C1ql/C1QTNF13 Lentiviral expression plasmid for C1QL3 lentivirus packaging, C1QL3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to C1QL3/C1ql products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005146 Human C1QL3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005146
Gene Name C1QL3
Accession Number NM_001010908
Gene ID 389941
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 768 bp
Gene Alias C1ql,C1QTNF13,CTRP13,K100
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGCTGCTGCTGGTGATCCTCATCCCGGTGCTGGTGAGCTCGGCCGGCACGTCGGCGCACTACGAGATGCTGGGCACCTGCCGCATGGTCTGCGACCCCTACGGGGGCACCAAGGCGCCCAGCACCGCTGCCACGCCCGACCGCGGCCTCATGCAGTCCCTGCCCACCTTCATCCAGGGCCCCAAAGGCGAGGCCGGCAGGCCCGGGAAGGCGGGTCCGCGCGGGCCCCCCGGAGAGCCCGGGCCACCCGGCCCCATGGGGCCCCCGGGCGAGAAGGGCGAGCCGGGCCGCCAAGGCCTGCCGGGCCCGCCCGGGGCGCCCGGCCTGAACGCGGCCGGGGCCATCAGCGCCGCCACCTACAGCACGGTGCCCAAGATCGCCTTCTACGCCGGCCTCAAGCGGCAGCATGAAGGCTACGAGGTGCTCAAGTTCGACGACGTGGTCACCAACCTCGGAAACCACTACGACCCCACCACCGGCAAGTTCACCTGCTCCATCCCGGGCATCTACTTCTTCACCTACCACGTCCTGATGCGCGGAGGGGACGGCACCAGCATGTGGGCTGATCTCTGCAAAAACAACCAGGTGCGTGCTAGTGCAATTGCCCAAGATGCTGATCAGAATTACGACTATGCCAGTAACAGTGTGGTTCTTCATTTGGAGCCGGGAGATGAAGTCTATATCAAATTAGATGGCGGGAAAGCCCATGGAGGAAACAACAACAAATACAGCACGTTTTCTGGATTTATTATTTATGCTGACTGA
ORF Protein Sequence MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0710-Ab Anti-C1QL3/ C1QTNF13/ C1ql functional antibody
    Target Antigen GM-Tg-g-SE0710-Ag C1QL3 protein
    ORF Viral Vector pGMLP005146 Human C1QL3 Lentivirus plasmid
    ORF Viral Vector vGMLP005146 Human C1QL3 Lentivirus particle


    Target information

    Target ID GM-SE0710
    Target Name C1QL3
    Gene ID 389941, 227580, 100429967, 680404, 101100731, 606995, 614045, 100068517
    Gene Symbol and Synonyms 1110065A22Rik,Adij,C1ql,C1QL3,C1QTNF13,CTRP13,K100
    Uniprot Accession Q5VWW1
    Uniprot Entry Name C1QL3_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000165985
    Target Classification Not Available

    Predicted to enable identical protein binding activity. Predicted to act upstream of or within regulation of synapse organization. Predicted to be located in extracellular region. Predicted to be part of collagen trimer. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.