Human PRB3/G1/PRG ORF/cDNA clone-Lentivirus particle (NM_006249)

Cat. No.: vGMLP005149

Pre-made Human PRB3/G1/PRG Lentiviral expression plasmid for PRB3 lentivirus packaging, PRB3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PRB3/G1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005149 Human PRB3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005149
Gene Name PRB3
Accession Number NM_006249
Gene ID 5544
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 930 bp
Gene Alias G1,PRG
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTACTGATTCTGCTGTCGGTGGCCCTGCTGGCCCTGAGCTCAGCTCAGAGCTTAAATGAAGATGTCAGCCAGGAAGAATCTCCCTCCGTAATATCAGGAAAGCCAGAAGGACGACGCCCACAAGGAGGAAACCAGCCCCAACGTACCCCACCTCCTCCAGGAAAGCCAGAAGGACGACCCCCACAAGGAGGCAACCAGTCCCAAGGTCCCCCACCTCGTCCAGGAAAGCCAGAAGGACCACCCCCACAAGGAGGAAACCAGTCCCAAGGTCCCCCACCTCGTCCGGGAAAGCCAGAAGGACAACCCCCACAAGGAGGAAACCAGTCCCAAGGTCCCCCACCTCGTCCGGGAAAGCCAGAAGGACCACCCCCACAAGGAGGAAACCAGTCCCAAGGTCCCCCGCCTCGTCCGGGAAAGCCAGAAGGACCACCCCCACAAGGAGGAAACCAGTCCCAAGGTCCCCCGCCTCGTCCGGGAAAGCCAGAAGGACCACCCCCACAAGGAGGAAACCAGTCCCAAGGTCCCCCGCCTCATCCGGGAAAGCCAGAAGGACCACCCCCACAAGGAGGAAACCAGTCCCAAGGTCCCCCACCTCGTCCGGGAAAGCCAGAAGGACCACCCCCACAAGGAGGAAACCAGTCCCAAGGTCCCCCACCTCGTCCAGGAAAGCCAGAAGGACCACCTTCACAAGGAGGCAACAAACCTCAAGGTCCCCCACCTCATCCAGGAAAGCCACAAGGACCACCCCCACAAGAAGGTAACAAACCTCAACGTCCCCCTCCTCCAGGAAGGCCACAAGGACCACCCCCACCAGGAGGCAATCCCCAGCAGCCTCTGCCACCTCCCGCTGGAAAGCCCCAGGGACCACCTCCACCTCCTCAAGGGGGCAGACCACACAGACCTCCCCAGGGACAGCCTCCCCAGTAA
ORF Protein Sequence MLLILLSVALLALSSAQSLNEDVSQEESPSVISGKPEGRRPQGGNQPQRTPPPPGKPEGRPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGQPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPHPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPSQGGNKPQGPPPHPGKPQGPPPQEGNKPQRPPPPGRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGGRPHRPPQGQPPQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1202-Ab Anti-PRB3/ G1/ PRG functional antibody
    Target Antigen GM-Tg-g-SE1202-Ag PRB3 protein
    ORF Viral Vector pGMLP005149 Human PRB3 Lentivirus plasmid
    ORF Viral Vector vGMLP005149 Human PRB3 Lentivirus particle


    Target information

    Target ID GM-SE1202
    Target Name PRB3
    Gene ID 5544
    Gene Symbol and Synonyms G1,PRB3,PRG
    Uniprot Accession Q04118
    Uniprot Entry Name PRB3_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000197870
    Target Classification Not Available

    This gene encodes a member of the heterogeneous family of basic, proline-rich, human salivary glycoproteins. Multiple alleles of this gene exhibiting variations in the length of the tandem repeats have been identified. The reference genome encodes the "Long" allele. The protein isoforms encoded by this gene are recognized as the "first line of oral defense" against the detrimental effects of polyphenols in the diet and pathogen infections. This gene is located in a cluster of closely related salivary proline-rich proteins on chromosome 12. [provided by RefSeq, Nov 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.