Human PRH1/Db-s/PA ORF/cDNA clone-Lentivirus particle (NM_001291315)
Cat. No.: vGMLP005150
Pre-made Human PRH1/Db-s/PA Lentiviral expression plasmid for PRH1 lentivirus packaging, PRH1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PRH2/PRH1/Db-s products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP005150 | Human PRH1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP005150 |
| Gene Name | PRH1 |
| Accession Number | NM_001291315 |
| Gene ID | 5554 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 603 bp |
| Gene Alias | Db-s,PA,PIF-S,Pr1/Pr2,PRH2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTGGAGGGGAATAGACTCCATCTATCCATATGAGCTGCTGCAGAAGAATATTTTGCCTGCTGGAACCTGCTGTATCTACTCAAGAGTGGAAGTTTTCACAGATGTCAGCCAGGAAGATGTTCCCCTCGTAATATCAGATGGAGGAGACTCTGAGCAGTTCCTAGATGAGGAGCGTCAGGGACCACCTTTGGGAGGACAGCAATCTCAACCCTCTGCTGGTGATGGGAACCAGGATGATGGCCCTCAGCAGGGACCACCCCAACAAGGAGGCCAGCAGCAACAAGGTCCACCACCTCCTCAGGGAAAGCCACAAGGACCACCCCAACAAGGAGGCCAGCAGCAACAAGGTCCACCACCTCCTCAGGGAAAGCCACAAGGACCACCCCAACAGGGAGGCCATCCCCCTCCTCCTCAAGGAAGGCCACAAGGACCACCCCAACAGGGAGGCCATCCCCGTCCTCCTCGAGGAAGGCCACAAGGACCACCCCAACAGGGAGGCCATCAGCAAGGTCCTCCCCCACCTCCTCCTGGAAAGCCCCAGGGACCACCTCCCCAAGGGGGCCGCCCACAAGGACCTCCACAGGGGCAGTCTCCTCAGTAA |
| ORF Protein Sequence | MWRGIDSIYPYELLQKNILPAGTCCIYSRVEVFTDVSQEDVPLVISDGGDSEQFLDEERQGPPLGGQQSQPSAGDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1205-Ab | Anti-PRPC/ PRH2/ PRP-1/PRP-2 functional antibody |
| Target Antigen | GM-Tg-g-SE1205-Ag | PRH2 protein |
| ORF Viral Vector | pGMLP005150 | Human PRH1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP005150 | Human PRH1 Lentivirus particle |
Target information
| Target ID | GM-SE1205 |
| Target Name | PRH2 |
| Gene ID | 5555 |
| Gene Symbol and Synonyms | Pr,pr1/Pr2,PRH2,PRP-1/PRP-2 |
| Uniprot Accession | P02810 |
| Uniprot Entry Name | PRPC_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000134551 |
| Target Classification | Not Available |
This gene encodes a member of the heterogeneous family of proline-rich salivary glycoproteins. The encoded preproprotein undergoes proteolytic processing to generate one or more mature isoforms before secretion from the parotid and submandibular/sublingual glands. In western population this locus is commonly biallelic and encodes proline-rich protein (PRP) isoforms, PRP-1 and PRP-2. The reference genome encodes the PRP-1 allele. Certain alleles of this gene are associated with susceptibility to dental caries. This gene is located in a cluster of closely related salivary proline-rich proteins on chromosome 12. [provided by RefSeq, Oct 2015]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


