Human CDK5R1/CDK5P35/CDK5R ORF/cDNA clone-Lentivirus particle (XM_017025281.1)
Cat. No.: vGMLP005443
Pre-made Human CDK5R1/CDK5P35/CDK5R Lentiviral expression plasmid for CDK5R1 lentivirus packaging, CDK5R1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CDK5R1/CDK5P35 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP005443 | Human CDK5R1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP005443 |
| Gene Name | CDK5R1 |
| Accession Number | XM_017025281.1 |
| Gene ID | 8851 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 924 bp |
| Gene Alias | CDK5P35,CDK5R,NCK5A,p23,p25,p35,p35nck5a |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGGCACGGTGCTGTCCCTGTCTCCCAGCTACCGGAAGGCCACGCTGTTTGAGGATGGCGCGGCCACCGTGGGCCACTATACGGCCGTACAGAACAGCAAGAACGCCAAGGACAAGAACCTGAAGCGCCACTCCATCATCTCCGTGCTGCCTTGGAAGAGAATCGTGGCCGTGTCGGCCAAGAAGAAGAACTCCAAGAAGGTGCAGCCCAACAGCAGCTACCAGAACAACATCACGCACCTCAACAATGAGAACCTGAAGAAGTCGCTGTCGTGCGCCAACCTGTCCACATTCGCCCAGCCCCCACCGGCCCAGCCGCCTGCACCCCCGGCCAGCCAGCTCTCGGGTTCCCAGACCGGGGGCTCCTCCTCAGTCAAGAAAGCCCCTCACCCTGCCGTCACCTCCGCAGGGACGCCCAAACGGGTCATCGTCCAGGCGTCCACCAGTGAGCTGCTTCGCTGCCTGGGTGAGTTTCTCTGCCGCCGGTGCTACCGCCTGAAGCACCTGTCCCCCACGGACCCCGTGCTCTGGCTGCGCAGCGTGGACCGCTCGCTGCTTCTGCAGGGCTGGCAGGACCAGGGCTTCATCACGCCGGCCAACGTGGTCTTCCTCTACATGCTCTGCAGGGATGTTATCTCCTCCGAGGTGGGCTCGGATCACGAGCTCCAGGCCGTCCTGCTGACATGCCTGTACCTCTCCTACTCCTACATGGGCAACGAGATCTCCTACCCGCTCAAGCCCTTCCTGGTGGAGAGCTGCAAGGAGGCCTTTTGGGACCGTTGCCTCTCTGTCATCAACCTCATGAGCTCAAAGATGCTGCAGATAAATGCCGACCCACACTACTTCACACAGGTCTTCTCCGACCTGAAGAACGAGAGCGGCCAGGAGGACAAGAAGCGGCTCCTCCTAGGCCTGGATCGGTGA |
| ORF Protein Sequence | MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T09513-Ab | Anti-CDK5R1 monoclonal antibody |
| Target Antigen | GM-Tg-g-T09513-Ag | CDK5R1 protein |
| ORF Viral Vector | pGMLP005443 | Human CDK5R1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP005443 | Human CDK5R1 Lentivirus particle |
Target information
| Target ID | GM-T09513 |
| Target Name | CDK5R1 |
| Gene ID | 8851, 12569, 714274, 116671, 101094890, 491154, 282173, 100071764 |
| Gene Symbol and Synonyms | CDK5P35,CDK5R,CDK5R1,D11Bwg0379e,NCK5A,p23,p25,P25/P35,p35,p35nck5a |
| Uniprot Accession | Q15078 |
| Uniprot Entry Name | CD5R1_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Lung Cancer |
| Gene Ensembl | ENSG00000176749 |
| Target Classification | Not Available |
The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


