Human NME3/c371H6.2/DR-nm23 ORF/cDNA clone-Lentivirus particle (NM_002513.2)

Cat. No.: vGMLP005518

Pre-made Human NME3/c371H6.2/DR-nm23 Lentiviral expression plasmid for NME3 lentivirus packaging, NME3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NME3/c371H6.2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005518 Human NME3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005518
Gene Name NME3
Accession Number NM_002513.2
Gene ID 4832
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 510 bp
Gene Alias c371H6.2,DR-nm23,NDPK-C,NDPKC,NM23-H3,NM23H3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATCTGCCTGGTGCTGACCATCTTCGCTAACCTCTTCCCCGCGGCCTGCACCGGCGCACACGAACGCACCTTCCTGGCCGTGAAGCCGGACGGCGTGCAGCGGCGGCTGGTGGGCGAGATTGTGCGGCGCTTCGAGAGGAAGGGCTTCAAGTTGGTGGCGCTGAAGCTGGTGCAGGCCTCCGAGGAGCTGCTGCGTGAGCACTACGCCGAGCTGCGTGAACGCCCGTTCTACGGCCGCCTTGTCAAGTATATGGCCTCCGGGCCGGTGGTGGCCATGGTATGGCAGGGGCTGGACGTGGTGCGCACCTCGCGGGCGCTCATCGGAGCCACGAACCCGGCCGACGCCCCGCCCGGCACCATCCGCGGGGATTTCTGCATCGAGGTTGGCAAGAACCTGATTCACGGCAGCGACTCGGTGGAGAGTGCCCGCCGCGAGATCGCTCTCTGGTTCCGCGCAGACGAGCTCCTCTGCTGGGAGGACAGCGCTGGGCACTGGCTGTATGAGTAG
ORF Protein Sequence MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1445-Ab Anti-NDK3/ NME3/ DR-nm23 functional antibody
    Target Antigen GM-Tg-g-SE1445-Ag NME3 protein
    ORF Viral Vector pGMLP005518 Human NME3 Lentivirus plasmid
    ORF Viral Vector vGMLP005518 Human NME3 Lentivirus particle


    Target information

    Target ID GM-SE1445
    Target Name NME3
    Gene ID 4832, 79059, 722479, 85269, 111558223, 100856596, 515663, 111767590
    Gene Symbol and Synonyms 1810009F08Rik,c371H6.2,DR-nm23,Ndk3,NDPK-C,NDPKC,Nm23-DR,NM23-H3,Nm23-M3,NM23H3,NME3
    Uniprot Accession Q13232
    Uniprot Entry Name NDK3_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000103024
    Target Classification Not Available

    Predicted to enable nucleoside diphosphate kinase activity. Predicted to be involved in apoptotic process and nucleotide metabolic process. Predicted to be located in cytosol. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.