Human RAC3 ORF/cDNA clone-Lentivirus particle (NM_005052.2)

Cat. No.: vGMLP005652

Pre-made Human RAC3/ Lentiviral expression plasmid for RAC3 lentivirus packaging, RAC3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RAC3/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005652 Human RAC3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005652
Gene Name RAC3
Accession Number NM_005052.2
Gene ID 5881
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 579 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGGCCATCAAGTGCGTGGTGGTCGGCGACGGCGCCGTGGGGAAGACATGCTTGCTGATCAGCTACACGACCAACGCCTTCCCCGGAGAGTACATCCCCACCGTTTTTGACAACTACTCTGCCAACGTGATGGTGGACGGGAAACCAGTCAACTTGGGGCTGTGGGACACAGCGGGTCAGGAGGACTACGATCGGCTGCGGCCACTCTCCTACCCCCAAACTGACGTCTTTCTGATCTGCTTCTCTCTGGTGAGCCCGGCCTCCTTCGAGAATGTTCGTGCCAAGTGGTACCCGGAGGTGCGGCACCACTGCCCCCACACGCCCATCCTCCTGGTGGGCACCAAGCTGGACCTCCGCGACGACAAGGACACCATTGAGCGGCTGCGGGACAAGAAGCTGGCACCCATCACCTACCCACAGGGCCTGGCCATGGCCCGGGAGATTGGCTCTGTGAAATACCTGGAGTGCTCAGCCCTGACCCAGCGGGGCCTGAAGACAGTGTTTGACGAGGCGATCCGCGCGGTGCTCTGCCCGCCCCCAGTGAAGAAGCCGGGGAAGAAGTGCACCGTCTTCTAG
ORF Protein Sequence MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T06525-Ab Anti-RAC3 monoclonal antibody
    Target Antigen GM-Tg-g-T06525-Ag RAC3 protein
    ORF Viral Vector pGMLP000359 Human RAC3 Lentivirus plasmid
    ORF Viral Vector pGMLP005652 Human RAC3 Lentivirus plasmid
    ORF Viral Vector pGMLV001032 Human RAC3 Lentivirus plasmid
    ORF Viral Vector vGMLP000359 Human RAC3 Lentivirus particle
    ORF Viral Vector vGMLP005652 Human RAC3 Lentivirus particle
    ORF Viral Vector vGMLV001032 Human RAC3 Lentivirus particle


    Target information

    Target ID GM-T06525
    Target Name RAC3
    Gene ID 5881, 170758, 719305, 688319, 101080496, 106559217, 619066, 100054738
    Gene Symbol and Synonyms Rac1B,RAC3
    Uniprot Accession P60763
    Uniprot Entry Name RAC3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Breast Cancer
    Gene Ensembl ENSG00000169750
    Target Classification Not Available

    Note: RAC3 (Gene ID: 5881) and NCOA3 (Gene ID: 8202) share the RAC3 symbol/alias in common. RAC3 is a widely used alternative name for nuclear receptor coactivator 3 (NCOA3), which can be confused with the official symbol for ras-related C3 botulinum toxin substrate 3 (RAC3). [06 Jul 2018]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.