Human HMGA2/BABL/HMGI-C ORF/cDNA clone-Lentivirus particle (NM_003483.4)
Cat. No.: vGMLV000254
Pre-made Human HMGA2/BABL/HMGI-C Lentiviral expression plasmid for HMGA2 lentivirus packaging, HMGA2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
HMGA2/BABL products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV000254 | Human HMGA2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV000254 |
| Gene Name | HMGA2 |
| Accession Number | NM_003483.4 |
| Gene ID | 8091 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 330 bp |
| Gene Alias | BABL,HMGI-C,HMGIC,LIPO,STQTL9 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGCGCACGCGGTGAGGGCGCGGGGCAGCCGTCCACTTCAGCCCAGGGACAACCTGCCGCCCCAGCGCCTCAGAAGAGAGGACGCGGCCGCCCCAGGAAGCAGCAGCAAGAACCAACCGGTGAGCCCTCTCCTAAGAGACCCAGGGGAAGACCCAAAGGCAGCAAAAACAAGAGTCCCTCTAAAGCAGCTCAAAAGAAAGCAGAAGCCACTGGAGAAAAACGGCCAAGAGGCAGACCTAGGAAATGGCCACAACAAGTTGTTCAGAAGAAGCCTGCTCAGGAGGAAACTGAAGAGACATCCTCACAAGAGTCTGCCGAAGAGGACTAG |
| ORF Protein Sequence | MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T48166-Ab | Anti-HMGA2 monoclonal antibody |
| Target Antigen | GM-Tg-g-T48166-Ag | HMGA2 protein |
| ORF Viral Vector | pGMLV000253 | Human HMGA2 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000254 | Human HMGA2 Lentivirus plasmid |
| ORF Viral Vector | vGMLV000253 | Human HMGA2 Lentivirus particle |
| ORF Viral Vector | vGMLV000254 | Human HMGA2 Lentivirus particle |
Target information
| Target ID | GM-T48166 |
| Target Name | HMGA2 |
| Gene ID | 8091, 15364, 717721, 84017, 111561386, 100271859, 100297155, 102149270 |
| Gene Symbol and Synonyms | 9430083A20Rik,BABL,HMGA2,HMGI-C,HMGIC,LIPO,pg,pygmy,SRS5,STQTL9 |
| Uniprot Accession | P52926 |
| Uniprot Entry Name | HMGA2_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | Cancer |
| Gene Ensembl | ENSG00000149948 |
| Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


