Human HMGA2/BABL/HMGI-C ORF/cDNA clone-Lentivirus particle (NM_003483.4)

Cat. No.: vGMLV000254

Pre-made Human HMGA2/BABL/HMGI-C Lentiviral expression plasmid for HMGA2 lentivirus packaging, HMGA2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to HMGA2/BABL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV000254 Human HMGA2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV000254
Gene Name HMGA2
Accession Number NM_003483.4
Gene ID 8091
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 330 bp
Gene Alias BABL,HMGI-C,HMGIC,LIPO,STQTL9
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCGCACGCGGTGAGGGCGCGGGGCAGCCGTCCACTTCAGCCCAGGGACAACCTGCCGCCCCAGCGCCTCAGAAGAGAGGACGCGGCCGCCCCAGGAAGCAGCAGCAAGAACCAACCGGTGAGCCCTCTCCTAAGAGACCCAGGGGAAGACCCAAAGGCAGCAAAAACAAGAGTCCCTCTAAAGCAGCTCAAAAGAAAGCAGAAGCCACTGGAGAAAAACGGCCAAGAGGCAGACCTAGGAAATGGCCACAACAAGTTGTTCAGAAGAAGCCTGCTCAGGAGGAAACTGAAGAGACATCCTCACAAGAGTCTGCCGAAGAGGACTAG
ORF Protein Sequence MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T48166-Ab Anti-HMGA2 monoclonal antibody
    Target Antigen GM-Tg-g-T48166-Ag HMGA2 protein
    ORF Viral Vector pGMLV000253 Human HMGA2 Lentivirus plasmid
    ORF Viral Vector pGMLV000254 Human HMGA2 Lentivirus plasmid
    ORF Viral Vector vGMLV000253 Human HMGA2 Lentivirus particle
    ORF Viral Vector vGMLV000254 Human HMGA2 Lentivirus particle


    Target information

    Target ID GM-T48166
    Target Name HMGA2
    Gene ID 8091, 15364, 717721, 84017, 111561386, 100271859, 100297155, 102149270
    Gene Symbol and Synonyms 9430083A20Rik,BABL,HMGA2,HMGI-C,HMGIC,LIPO,pg,pygmy,SRS5,STQTL9
    Uniprot Accession P52926
    Uniprot Entry Name HMGA2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000149948
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.