Human ID1/bHLHb24/ID ORF/cDNA clone-Lentivirus particle (NM_002165.3)
Cat. No.: vGMLV000299
Pre-made Human ID1/bHLHb24/ID Lentiviral expression plasmid for ID1 lentivirus packaging, ID1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
ID1/bHLHb24 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV000299 | Human ID1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV000299 |
| Gene Name | ID1 |
| Accession Number | NM_002165.3 |
| Gene ID | 3397 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 468 bp |
| Gene Alias | bHLHb24,ID |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAAAGTCGCCAGTGGCAGCACCGCCACCGCCGCCGCGGGCCCCAGCTGCGCGCTGAAGGCCGGCAAGACAGCGAGCGGTGCGGGCGAGGTGGTGCGCTGTCTGTCTGAGCAGAGCGTGGCCATCTCGCGCTGCGCCGGGGGCGCCGGGGCGCGCCTGCCTGCCCTGCTGGACGAGCAGCAGGTAAACGTGCTGCTCTACGACATGAACGGCTGTTACTCACGCCTCAAGGAGCTGGTGCCCACCCTGCCCCAGAACCGCAAGGTGAGCAAGGTGGAGATTCTCCAGCACGTCATCGACTACATCAGGGACCTTCAGTTGGAGCTGAACTCGGAATCCGAAGTTGGAACCCCCGGGGGCCGAGGGCTGCCGGTCCGGGCTCCGCTCAGCACCCTCAACGGCGAGATCAGCGCCCTGACGGCCGAGGCGGCATGCGTTCCTGCGGACGATCGCATCTTGTGTCGCTGA |
| ORF Protein Sequence | MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1486-Ab | Anti-ID1/ ID/ bHLHb24 functional antibody |
| Target Antigen | GM-Tg-g-SE1486-Ag | ID1 protein |
| ORF Viral Vector | pGMLV000299 | Human ID1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000839 | Human ID1 Lentivirus plasmid |
| ORF Viral Vector | vGMLV000299 | Human ID1 Lentivirus particle |
| ORF Viral Vector | vGMLV000839 | Human ID1 Lentivirus particle |
Target information
| Target ID | GM-SE1486 |
| Target Name | ID1 |
| Gene ID | 3397, 15901, 713160, 25261, 101097058, 609779, 497011, 100068419 |
| Gene Symbol and Synonyms | bHLHb24,D2Wsu140e,ID,ID1,ID125A,Idb1 |
| Uniprot Accession | P41134 |
| Uniprot Entry Name | ID1_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000125968 |
| Target Classification | Not Available |
The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


