Human DEFB4A/BD-2/DEFB-2 ORF/cDNA clone-Lentivirus particle (NM_004942.3)

Cat. No.: vGMLV000712

Pre-made Human DEFB4A/BD-2/DEFB-2 Lentiviral expression plasmid for DEFB4A lentivirus packaging, DEFB4A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to DEFB4A/BD-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV000712 Human DEFB4A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV000712
Gene Name DEFB4A
Accession Number NM_004942.3
Gene ID 1673
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 195 bp
Gene Alias BD-2,DEFB-2,DEFB102,DEFB2,DEFB4,HBD-2,SAP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGGTCTTGTATCTCCTCTTCTCGTTCCTCTTCATATTCCTGATGCCTCTTCCAGGTGTTTTTGGTGGTATAGGCGATCCTGTTACCTGCCTTAAGAGTGGAGCCATATGTCATCCAGTCTTTTGCCCTAGAAGGTATAAACAAATTGGCACCTGTGGTCTCCCTGGAACAAAATGCTGCAAAAAGCCATGA
ORF Protein Sequence MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T43881-Ab Anti-DFB4A/ DEFB4A/ BD-2 functional antibody
    Target Antigen GM-Tg-g-T43881-Ag DEFB4A protein
    ORF Viral Vector pGMLP004542 Human DEFB4A Lentivirus plasmid
    ORF Viral Vector pGMLV000712 Human DEFB4A Lentivirus plasmid
    ORF Viral Vector vGMLP004542 Human DEFB4A Lentivirus particle
    ORF Viral Vector vGMLV000712 Human DEFB4A Lentivirus particle


    Target information

    Target ID GM-T43881
    Target Name DEFB4A
    Gene ID 1673
    Gene Symbol and Synonyms BD-2,DEFB-2,DEFB102,DEFB2,DEFB4,DEFB4A,HBD-2,SAP1
    Uniprot Accession O15263
    Uniprot Entry Name DFB4A_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000171711
    Target Classification Not Available

    Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.