Human ROMO1/bA353C18.2/C20orf52 ORF/cDNA clone-Lentivirus particle (NM_080748)

Cat. No.: vGMLV001334

Pre-made Human ROMO1/bA353C18.2/C20orf52 Lentiviral expression plasmid for ROMO1 lentivirus packaging, ROMO1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ROMO1/bA353C18.2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV001334 Human ROMO1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV001334
Gene Name ROMO1
Accession Number NM_080748
Gene ID 140823
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 240 bp
Gene Alias bA353C18.2,C20orf52,MTGM,MTGMP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCGGTGGCCGTGGGTCCCTACGGACAGTCCCAGCCAAGCTGCTTCGACCGTGTCAAAATGGGCTTCGTGATGGGTTGCGCCGTGGGCATGGCGGCCGGGGCGCTCTTCGGCACCTTTTCCTGTCTCAGGATCGGAATGCGGGGTCGAGAGCTGATGGGCGGCATTGGGAAAACCATGATGCAGAGTGGCGGCACCTTTGGCACATTCATGGCCATTGGGATGGGCATCCGATGCTAA
ORF Protein Sequence MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1535-Ab Anti-ROMO1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1535-Ag ROMO1 protein
    ORF Viral Vector pGMLV001334 Human ROMO1 Lentivirus plasmid
    ORF Viral Vector pGMAD000883 Human ROMO1 Adenovirus plasmid
    ORF Viral Vector vGMLV001334 Human ROMO1 Lentivirus particle
    ORF Viral Vector vGMAD000883 Human ROMO1 Adenovirus particle


    Target information

    Target ID GM-IP1535
    Target Name ROMO1
    Gene ID 140823, 67067, 711369, 679572, 101099955, 477215, 618530, 100069618
    Gene Symbol and Synonyms 2010100O12Rik,bA353C18.2,C13H20ORF52,C20orf52,MTGM,MTGMP,ROMO1
    Uniprot Accession P60602
    Uniprot Entry Name ROMO1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000125995
    Target Classification Not Available

    The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage. [provided by RefSeq, Nov 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.