Human CCL5/D17S136E/eoCP ORF/cDNA clone-Lentivirus particle (NM_002985.3)
Cat. No.: vGMLV001626
Pre-made Human CCL5/D17S136E/eoCP Lentiviral expression plasmid for CCL5 lentivirus packaging, CCL5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CCL5/D17S136E products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV001626 | Human CCL5 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV001626 |
| Gene Name | CCL5 |
| Accession Number | NM_002985.3 |
| Gene ID | 6352 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 276 bp |
| Gene Alias | D17S136E,eoCP,RANTES,SCYA5,SIS-delta,SISd,TCP228 |
| Fluorescent Reporter | ZsGreen-Firefly luciferase |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAAGGTCTCCGCGGCAGCCCTCGCTGTCATCCTCATTGCTACTGCCCTCTGCGCTCCTGCATCTGCCTCCCCATATTCCTCGGACACCACACCCTGCTGCTTTGCCTACATTGCCCGCCCACTGCCCCGTGCCCACATCAAGGAGTATTTCTACACCAGTGGCAAGTGCTCCAACCCAGCAGTCGTCTTTGTCACCCGAAAGAACCGCCAAGTGTGTGCCAACCCAGAGAAGAAATGGGTTCGGGAGTACATCAACTCTTTGGAGATGAGCTAG |
| ORF Protein Sequence | MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T16263-Ab | Anti-CCL5/ D17S136E/ RANTES functional antibody |
| Target Antigen | GM-Tg-g-T16263-Ag | CCL5 protein |
| Cytokine | cks-Tg-g-GM-T16263 | chemokine (C-C motif) ligand 5 (CCL5) protein & antibody |
| ORF Viral Vector | pGMLV001580 | Human CCL5 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001626 | Human CCL5 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001699 | Human CCL5 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001882 | Human CCL5 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000013 | Human CCL5 Adenovirus plasmid |
| ORF Viral Vector | pGMAP000062 | Human CCL5 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000787 | Human CCL5 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLV001580 | Human CCL5 Lentivirus particle |
| ORF Viral Vector | vGMLV001626 | Human CCL5 Lentivirus particle |
| ORF Viral Vector | vGMLV001699 | Human CCL5 Lentivirus particle |
| ORF Viral Vector | vGMLV001882 | Human CCL5 Lentivirus particle |
| ORF Viral Vector | vGMAP000013 | Human CCL5 Adenovirus particle |
| ORF Viral Vector | vGMAP000062 | Human CCL5 Adenovirus particle |
Target information
| Target ID | GM-T16263 |
| Target Name | CCL5 |
| Gene ID | 6352, 20304, 574178, 81780, 493689, 403522, 327712, 100033925 |
| Gene Symbol and Synonyms | CCL5,D17S136E,eoCP,MuRantes,RANTES,SCYA5,SIS-delta,SISd,TCP228 |
| Uniprot Accession | P13501 |
| Uniprot Entry Name | CCL5_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | Breast Cancer, Type 1 diabetes mellitus, Chronic Kidney Disease |
| Gene Ensembl | ENSG00000271503 |
| Target Classification | Not Available |
This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


