Human CLEC3B/TN/TNA ORF/cDNA clone-Lentivirus particle (NM_003278.3)

Cat. No.: vGMLV001778

Pre-made Human CLEC3B/TN/TNA Lentiviral expression plasmid for CLEC3B lentivirus packaging, CLEC3B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CLEC3B/TN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV001778 Human CLEC3B Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV001778
Gene Name CLEC3B
Accession Number NM_003278.3
Gene ID 7123
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 609 bp
Gene Alias TN,TNA
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag HA (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGCTCTGGGGGGCCTACCTCCTCCTCTGCCTCTTCTCCCTCCTGACCCAGGTCACCACCGAGCCACCAACCCAGAAGCCCAAGAAGATTGTAAATGCCAAGAAAGATGTTGTGAACACAAAGATGTTTGAGGAGCTCAAGAGCCGTCTGGACACCCTGGCCCAGGAGGTGGCCCTGCTGAAGGAGCAGCAGGCCCTGCAGACGGTCTGCCTGAAGGGGACCAAGGTGCACATGAAATGCTTTCTGGCCTTCACCCAGACGAAGACCTTCCACGAGGCCAGCGAGGACTGCATCTCGCGCGGGGGCACCCTGGGCACCCCTCAGACTGGCTCGGAGAACGACGCCCTGTATGAGTACCTGCGCCAGAGCGTGGGCAACGAGGCCGAGATCTGGCTGGGCCTCAACGACATGGCGGCCGAGGGCACCTGGGTGGACATGACCGGCGCCCGCATCGCCTACAAGAACTGGGAGACTGAGATCACCGCGCAACCCGATGGCGGCAAGACCGAGAACTGCGCGGTCCTGTCAGGCGCGGCCAACGGCAAGTGGTTCGACAAGCGCTGCCGCGATCAGCTGCCCTACATCTGCCAGTTCGGGATCGTGTAG
ORF Protein Sequence MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0787-Ab Anti-TETN/ CLEC3B/ TN functional antibody
    Target Antigen GM-Tg-g-SE0787-Ag CLEC3B protein
    ORF Viral Vector pGMLP004739 Human Tn Lentivirus plasmid
    ORF Viral Vector pGMLV001778 Human CLEC3B Lentivirus plasmid
    ORF Viral Vector pGMPC000661 Human CLEC3B Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP004739 Human Tn Lentivirus particle
    ORF Viral Vector vGMLV001778 Human CLEC3B Lentivirus particle


    Target information

    Target ID GM-SE0787
    Target Name CLEC3B
    Gene ID 7123, 21922, 106996937, 100912012, 101082218, 609596, 515783, 100630686
    Gene Symbol and Synonyms CLEC3B,MCDR4,TN,TNA
    Uniprot Accession P05452
    Uniprot Entry Name TETN_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease ovarian cancer
    Gene Ensembl ENSG00000163815
    Target Classification Not Available

    Enables calcium ion binding activity; heparin binding activity; and kringle domain binding activity. Involved in bone mineralization and cellular response to transforming growth factor beta stimulus. Located in cytoplasm; extracellular space; and granular component. Part of collagen-containing extracellular matrix. Implicated in osteoarthritis. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.