Human CELA3B/CBPP/ELA3B ORF/cDNA clone-Lentivirus particle (NM_007352)
Cat. No.: vGMLV002190
Pre-made Human CELA3B/CBPP/ELA3B Lentiviral expression plasmid for CELA3B lentivirus packaging, CELA3B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CELA3B/CBPP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLV002190 | Human CELA3B Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLV002190 |
Gene Name | CELA3B |
Accession Number | NM_007352 |
Gene ID | 23436 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 813 bp |
Gene Alias | CBPP,ELA3B |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGATGCTCCGGCTGCTCAGTTCCCTCCTCCTTGTGGCCGTTGCCTCAGGCTATGGCCCACCTTCCTCTCGCCCTTCCAGCCGCGTTGTCAATGGTGAGGATGCGGTCCCCTACAGCTGGCCCTGGCAGGTTTCCCTGCAGTATGAGAAAAGCGGAAGCTTCTACCACACCTGTGGCGGTAGCCTCATCGCCCCCGACTGGGTTGTGACTGCCGGCCACTGCATCTCGAGCTCCCGGACCTACCAGGTGGTGTTGGGCGAGTACGACCGTGCTGTGAAGGAGGGCCCCGAGCAGGTGATCCCCATCAACTCTGGGGACCTCTTTGTGCATCCACTCTGGAACCGCTCGTGTGTGGCCTGTGGCAATGACATCGCCCTCATCAAGCTCTCACGCAGCGCCCAGCTGGGAGACGCCGTCCAGCTCGCCTCACTCCCTCCGGCTGGTGACATCCTTCCCAACGAGACACCCTGCTACATCACCGGCTGGGGCCGTCTCTATACCAACGGGCCACTCCCAGACAAGCTGCAGGAGGCCCTGCTGCCGGTGGTGGACTATGAACACTGCTCCAGGTGGAACTGGTGGGGTTCCTCCGTGAAGAAGACCATGGTGTGTGCTGGAGGGGACATCCGCTCCGGCTGCAATGGTGACTCTGGAGGACCCCTCAACTGCCCCACAGAGGATGGTGGCTGGCAGGTCCATGGCGTGACCAGCTTTGTTTCTGCCTTTGGCTGCAACACCCGCAGGAAGCCCACGGTGTTCACTCGAGTCTCCGCCTTCATTGACTGGATTGAGGAGACCATAGCAAGCCACTAG |
ORF Protein Sequence | MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0758-Ab | Anti-CEL3B/ CELA3B/ CBPP functional antibody |
Target Antigen | GM-Tg-g-SE0758-Ag | CELA3B protein |
ORF Viral Vector | pGMLV002190 | Human CELA3B Lentivirus plasmid |
ORF Viral Vector | vGMLV002190 | Human CELA3B Lentivirus particle |
Target information
Target ID | GM-SE0758 |
Target Name | CELA3B |
Gene ID | 23436, 574236, 298567 |
Gene Symbol and Synonyms | CBPP,CELA3B,ELA1,ELA3B |
Uniprot Accession | P08861 |
Uniprot Entry Name | CEL3B_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000219073 |
Target Classification | Not Available |
Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3B has little elastolytic activity. Like most of the human elastases, elastase 3B is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3B preferentially cleaves proteins after alanine residues. Elastase 3B may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1, and excretion of this protein in fecal material is frequently used as a measure of pancreatic function in clinical assays. [provided by RefSeq, May 2009]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.