Human SUMO2/HSMT3/Smt3A ORF/cDNA clone-Lentivirus particle (NM_006937)
Cat. No.: vGMLV002558
Pre-made Human SUMO2/HSMT3/Smt3A Lentiviral expression plasmid for SUMO2 lentivirus packaging, SUMO2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SUMO2/HSMT3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV002558 | Human SUMO2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV002558 |
| Gene Name | SUMO2 |
| Accession Number | NM_006937 |
| Gene ID | 6613 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 288 bp |
| Gene Alias | HSMT3,Smt3A,SMT3B,SMT3H2,SUMO3 |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCGACGAAAAGCCCAAGGAAGGAGTCAAGACTGAGAACAACGATCATATTAATTTGAAGGTGGCGGGGCAGGATGGTTCTGTGGTGCAGTTTAAGATTAAGAGGCATACACCACTTAGTAAACTAATGAAAGCCTATTGTGAACGACAGGGATTGTCAATGAGGCAGATCAGATTCCGATTTGACGGGCAACCAATCAATGAAACAGACACACCTGCACAGTTGGAAATGGAGGATGAAGATACAATTGATGTGTTCCAACAGCAGACGGGAGGTGTCTACTGA |
| ORF Protein Sequence | MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-TA089-Ab | Anti-SUMO2 monoclonal antibody |
| Target Antigen | GM-Tg-g-TA089-Ag | SUMO2 protein |
| ORF Viral Vector | pGMLP000323 | Human SUMO2 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002558 | Human SUMO2 Lentivirus plasmid |
| ORF Viral Vector | pGMPC000058 | Human SUMO2 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001224 | Human SUMO2 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001863 | Human SUMO2 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000323 | Human SUMO2 Lentivirus particle |
| ORF Viral Vector | vGMLV002558 | Human SUMO2 Lentivirus particle |
Target information
| Target ID | GM-TA089 |
| Target Name | SUMO2 |
| Gene ID | 6613, 170930, 705512, 690244, 101094221, 474963, 286807, 100630536 |
| Gene Symbol and Synonyms | HSMT3,Smt3A,SMT3B,SMT3H2,SUMO-2,SUMO2,SUMO3 |
| Uniprot Accession | P61956 |
| Uniprot Entry Name | SUMO2_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000188612 |
| Target Classification | Not Available |
This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


