Human SPDEF/bA375E1.3/PDEF ORF/cDNA clone-Adenovirus plasmid (BC021299)

Cat. No.: pGMAP000029
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SPDEF/bA375E1.3/PDEF adenoviral expression plasmid for SPDEF adenovirus packaging, SPDEF adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SPDEF/bA375E1.3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000029
Gene Name SPDEF
Accession Number BC021299
Gene ID 25803
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 1008 bp
Gene Alias bA375E1.3,PDEF,RP11-375E1__A.3
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGGCAGCGCCAGCCCGGGTCTGAGCAGCGTATCCCCCAGCCACCTCCTGCTGCCCCCCGACACGGTGTCGCGGACAGGCTTGGAGAAGGCGGCAGCGGGGGCAGTGGGTCTCGAGAGACGGGACTGGAGTCCCAGTCCACCCGCCACGCCCGAGCAGGGCCTGTCCGCCTTCTACCTCTCCTACTTTGACATGCTGTACCCTGAGGACAGCAGCTGGGCAGCCAAGGCCCCTGGGGCCAGCAGTCGGGAGGAGCCACCTGAGGAGCCTGAGCAGTGCCCGGTCATTGACAGCCAAGCCCCAGCGGGCAGCCTGGACTTGGTGCCCGGCGGGCTGACCTTGGAGGAGCACTCGCTGGAGCAGGTGCAGTCCATGGTGGTGGGCGAAGTGCTCAAGGACATCGAGACGGCCTGCAAGCTGCTCAACATCACCGCAGATCCCATGGACTGGAGCCCCAGCAATGTGCAGAAGTGGCTCCTGTGGACAGAGCACCAATACCGGCTGCCCCCCATGGGCAAGGCCTTCCAGGAGCTGGCGGGCAAGGAGCTGTGCGCCATGTCGGAGGAGCAGTTCCGCCAGCGCTCGCCCCTGGGTGGGGATGTGCTGCACGCCCACCTGGACATCTGGAAGTCAGCGGCCTGGATGAAAGAGCGGACTTCACCTGGGGCGATTCACTACTGTGCCTCGACCAGTGAGGAGAGCTGGACCGACAGCGAGGTGGACTCATCATGCTCCGGGCAGCCCATCCACCTGTGGCAGTTCCTCAAGGAGTTGCTACTCAAGCCCCACAGCTATGGCCGCTTCATTAGGTGGCTCAACAAGGAGAAGGGCATCTTCAAAATTGAGGACTCAGCCCAGGTGGCCCGGCTGTGGGGCATCCGCAAGAACCGTCCCGCCATGAACTACGACAAGCTGAGCCGCTCCATCCGCCAGTATTACAAGAAGGGCATCATCCGGAAGCCAGACATCTCCCAGCGCCTCGTCTACCAGTTCGTGCACCCCATCTGA
ORF Protein Sequence MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T48518-Ab Anti-SPDEF monoclonal antibody
    Target Antigen GM-Tg-g-T48518-Ag SPDEF protein
    ORF Viral Vector pGMAP000029 Human SPDEF Adenovirus plasmid
    ORF Viral Vector vGMAP000029 Human SPDEF Adenovirus particle


    Target information

    Target ID GM-T48518
    Target Name SPDEF
    Gene ID 25803, 30051, 718648, 689210, 101096315, 481751, 497620, 100053106
    Gene Symbol and Synonyms bA375E1.3,PDEF,Pse,SPDEF
    Uniprot Accession O95238
    Uniprot Entry Name SPDEF_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000124664
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.