Human SPDEF/bA375E1.3/PDEF ORF/cDNA clone-Adenovirus plasmid (BC021299)
Cat. No.: pGMAP000029
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SPDEF/bA375E1.3/PDEF adenoviral expression plasmid for SPDEF adenovirus packaging, SPDEF adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
SPDEF/bA375E1.3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAP000029 |
Gene Name | SPDEF |
Accession Number | BC021299 |
Gene ID | 25803 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 1008 bp |
Gene Alias | bA375E1.3,PDEF,RP11-375E1__A.3 |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGGGCAGCGCCAGCCCGGGTCTGAGCAGCGTATCCCCCAGCCACCTCCTGCTGCCCCCCGACACGGTGTCGCGGACAGGCTTGGAGAAGGCGGCAGCGGGGGCAGTGGGTCTCGAGAGACGGGACTGGAGTCCCAGTCCACCCGCCACGCCCGAGCAGGGCCTGTCCGCCTTCTACCTCTCCTACTTTGACATGCTGTACCCTGAGGACAGCAGCTGGGCAGCCAAGGCCCCTGGGGCCAGCAGTCGGGAGGAGCCACCTGAGGAGCCTGAGCAGTGCCCGGTCATTGACAGCCAAGCCCCAGCGGGCAGCCTGGACTTGGTGCCCGGCGGGCTGACCTTGGAGGAGCACTCGCTGGAGCAGGTGCAGTCCATGGTGGTGGGCGAAGTGCTCAAGGACATCGAGACGGCCTGCAAGCTGCTCAACATCACCGCAGATCCCATGGACTGGAGCCCCAGCAATGTGCAGAAGTGGCTCCTGTGGACAGAGCACCAATACCGGCTGCCCCCCATGGGCAAGGCCTTCCAGGAGCTGGCGGGCAAGGAGCTGTGCGCCATGTCGGAGGAGCAGTTCCGCCAGCGCTCGCCCCTGGGTGGGGATGTGCTGCACGCCCACCTGGACATCTGGAAGTCAGCGGCCTGGATGAAAGAGCGGACTTCACCTGGGGCGATTCACTACTGTGCCTCGACCAGTGAGGAGAGCTGGACCGACAGCGAGGTGGACTCATCATGCTCCGGGCAGCCCATCCACCTGTGGCAGTTCCTCAAGGAGTTGCTACTCAAGCCCCACAGCTATGGCCGCTTCATTAGGTGGCTCAACAAGGAGAAGGGCATCTTCAAAATTGAGGACTCAGCCCAGGTGGCCCGGCTGTGGGGCATCCGCAAGAACCGTCCCGCCATGAACTACGACAAGCTGAGCCGCTCCATCCGCCAGTATTACAAGAAGGGCATCATCCGGAAGCCAGACATCTCCCAGCGCCTCGTCTACCAGTTCGTGCACCCCATCTGA |
ORF Protein Sequence | MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T48518-Ab | Anti-SPDEF monoclonal antibody |
Target Antigen | GM-Tg-g-T48518-Ag | SPDEF protein |
ORF Viral Vector | pGMAP000029 | Human SPDEF Adenovirus plasmid |
ORF Viral Vector | vGMAP000029 | Human SPDEF Adenovirus particle |
Target information
Target ID | GM-T48518 |
Target Name | SPDEF |
Gene ID | 25803, 30051, 718648, 689210, 101096315, 481751, 497620, 100053106 |
Gene Symbol and Synonyms | bA375E1.3,PDEF,Pse,SPDEF |
Uniprot Accession | O95238 |
Uniprot Entry Name | SPDEF_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000124664 |
Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.