Human VIP/MGC13587/PHM27 ORF/cDNA clone-Adenovirus plasmid (BC009794)

Cat. No.: pGMAP000149
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human VIP/MGC13587/PHM27 adenoviral expression plasmid for VIP adenovirus packaging, VIP adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to VIP/MGC13587 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000149
Gene Name VIP
Accession Number BC009794
Gene ID 7432
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 510 bp
Gene Alias MGC13587,PHM27
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGACACCAGAAATAAGGCCCAGCTCCTTGTGCTCCTGACTCTTCTCAGTGTGCTCTTCTCACAGACTTCGGCATGGCCTCTTTACAGGGCACCTTCTGCTCTCAGGTTGGGTGACAGAATACCCTTTGAGGGAGCAAATGAACCTGATCAAGTTTCATTAAAAGAAGACATTGACATGTTGCAAAATGCATTAGCTGAAAATGACACACCCTATTATGATGTATCCAGAAATGCCAGGCATGCTGATGGAGTTTTCACCAGTGACTTCAGTAAACTCTTGGGTCAACTTTCTGCCAAAAAGTACCTTGAGTCTCTTATGGGAAAACGTGTTAGTAACATCTCAGAAGACCCTGTACCAGTCAAACGTCACTCAGATGCAGTCTTCACTGACAACTATACCCGCCTTAGAAAACAAATGGCTGTAAAGAAATATTTGAACTCAATTCTGAATGGAAAGAGGAGCAGTGAGGGAGAATCTCCCGACTTTCCAGAAGAGTTAGAAAAATGA
ORF Protein Sequence MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T88213-Ab Anti-VIP/ PHM27 functional antibody
    Target Antigen GM-Tg-g-T88213-Ag VIP protein
    ORF Viral Vector pGMLV000792 Human VIP Lentivirus plasmid
    ORF Viral Vector pGMAP000149 Human VIP Adenovirus plasmid
    ORF Viral Vector vGMLV000792 Human VIP Lentivirus particle
    ORF Viral Vector vGMAP000149 Human VIP Adenovirus particle


    Target information

    Target ID GM-T88213
    Target Name VIP
    Gene ID 7432, 22353, 703566, 117064, 101101640, 484038, 280956, 100060155
    Gene Symbol and Synonyms PHM27,VIP,vip/phi27
    Uniprot Accession P01282
    Uniprot Entry Name VIP_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000146469
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Nov 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.