Human VIP/MGC13587/PHM27 ORF/cDNA clone-Adenovirus plasmid (BC009794)
Cat. No.: pGMAP000149
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human VIP/MGC13587/PHM27 adenoviral expression plasmid for VIP adenovirus packaging, VIP adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
VIP/MGC13587 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP000149 |
| Gene Name | VIP |
| Accession Number | BC009794 |
| Gene ID | 7432 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 510 bp |
| Gene Alias | MGC13587,PHM27 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGACACCAGAAATAAGGCCCAGCTCCTTGTGCTCCTGACTCTTCTCAGTGTGCTCTTCTCACAGACTTCGGCATGGCCTCTTTACAGGGCACCTTCTGCTCTCAGGTTGGGTGACAGAATACCCTTTGAGGGAGCAAATGAACCTGATCAAGTTTCATTAAAAGAAGACATTGACATGTTGCAAAATGCATTAGCTGAAAATGACACACCCTATTATGATGTATCCAGAAATGCCAGGCATGCTGATGGAGTTTTCACCAGTGACTTCAGTAAACTCTTGGGTCAACTTTCTGCCAAAAAGTACCTTGAGTCTCTTATGGGAAAACGTGTTAGTAACATCTCAGAAGACCCTGTACCAGTCAAACGTCACTCAGATGCAGTCTTCACTGACAACTATACCCGCCTTAGAAAACAAATGGCTGTAAAGAAATATTTGAACTCAATTCTGAATGGAAAGAGGAGCAGTGAGGGAGAATCTCCCGACTTTCCAGAAGAGTTAGAAAAATGA |
| ORF Protein Sequence | MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T88213-Ab | Anti-VIP/ PHM27 functional antibody |
| Target Antigen | GM-Tg-g-T88213-Ag | VIP protein |
| ORF Viral Vector | pGMLV000792 | Human VIP Lentivirus plasmid |
| ORF Viral Vector | pGMAP000149 | Human VIP Adenovirus plasmid |
| ORF Viral Vector | vGMLV000792 | Human VIP Lentivirus particle |
| ORF Viral Vector | vGMAP000149 | Human VIP Adenovirus particle |
Target information
| Target ID | GM-T88213 |
| Target Name | VIP |
| Gene ID | 7432, 22353, 703566, 117064, 101101640, 484038, 280956, 100060155 |
| Gene Symbol and Synonyms | PHM27,VIP,vip/phi27 |
| Uniprot Accession | P01282 |
| Uniprot Entry Name | VIP_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | Cancer |
| Gene Ensembl | ENSG00000146469 |
| Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Nov 2014]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


