Human ACP1/HAAP/MGC3499 ORF/cDNA clone-Adenovirus plasmid (BC007422)
Cat. No.: pGMAP000201
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human ACP1/HAAP/MGC3499 adenoviral expression plasmid for ACP1 adenovirus packaging, ACP1 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
ACP1/HAAP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP000201 |
| Gene Name | ACP1 |
| Accession Number | BC007422 |
| Gene ID | 52 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 477 bp |
| Gene Alias | HAAP,MGC3499 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGCGGAACAGGCTACCAAGTCCGTGCTGTTTGTGTGTCTGGGTAACATTTGTCGATCACCCATTGCAGAAGCAGTTTTCAGGAAACTTGTAACCGATCAAAACATCTCAGAGAATTGGGTCATTGACAGCGGTGCTGTTTCTGACTGGAACGTGGGCCGGTCCCCAGACCCAAGAGCTGTGAGCTGCCTAAGAAATCATGGCATTCACACAGCCCATAAAGCAAGACAGATTACCAAAGAAGATTTTGCCACATTTGATTATATACTATGTATGGATGAAAGCAATCTGAGAGATTTGAATAGAAAAAGTAATCAAGTTAAAACCTGCAAAGCTAAAATTGAACTACTTGGGAGCTATGATCCACAAAAACAACTTATTATTGAAGATCCCTATTATGGGAATGACTCTGACTTTGAGACGGTGTACCAGCAGTGTGTCAGGTGCTGCAGAGCGTTCTTGGAGAAGGCCCACTGA |
| ORF Protein Sequence | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0296-Ab | Anti-ACP1 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0296-Ag | ACP1 protein |
| ORF Viral Vector | pGMLP000524 | Human ACP1 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000201 | Human ACP1 Adenovirus plasmid |
| ORF Viral Vector | vGMLP000524 | Human ACP1 Lentivirus particle |
| ORF Viral Vector | vGMAP000201 | Human ACP1 Adenovirus particle |
Target information
| Target ID | GM-IP0296 |
| Target Name | ACP1 |
| Gene ID | 52, 11431, 721397, 24161, 101092352, 606814, 280977, 100057408 |
| Gene Symbol and Synonyms | 4632432E04Rik,Acp-1,ACP1,HAAP,Lmptp,LMW-PTP,LMWPTP |
| Uniprot Accession | P24666 |
| Uniprot Entry Name | PPAC_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000143727 |
| Target Classification | Not Available |
The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


