Human ACP1/HAAP/LMW-PTP ORF/cDNA clone-Lentivirus particle (NM_007099)

Cat. No.: vGMLP000524

Pre-made Human ACP1/HAAP/LMW-PTP Lentiviral expression plasmid for ACP1 lentivirus packaging, ACP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ACP1/HAAP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000524 Human ACP1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000524
Gene Name ACP1
Accession Number NM_007099
Gene ID 52
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 477 bp
Gene Alias HAAP,LMW-PTP,LMWPTP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGAACAGGCTACCAAGTCCGTGCTGTTTGTGTGTCTGGGTAACATTTGTCGATCACCCATTGCAGAAGCAGTTTTCAGGAAACTTGTAACCGATCAAAACATCTCAGAGAATTGGGTCATTGACAGCGGTGCTGTTTCTGACTGGAACGTGGGCCGGTCCCCAGACCCAAGAGCTGTGAGCTGCCTAAGAAATCATGGCATTCACACAGCCCATAAAGCAAGACAGATTACCAAAGAAGATTTTGCCACATTTGATTATATACTATGTATGGATGAAAGCAATCTGAGAGATTTGAATAGAAAAAGTAATCAAGTTAAAACCTGCAAAGCTAAAATTGAACTACTTGGGAGCTATGATCCACAAAAACAACTTATTATTGAAGATCCCTATTATGGGAATGACTCTGACTTTGAGACGGTGTACCAGCAGTGTGTCAGGTGCTGCAGAGCGTTCTTGGAGAAGGCCCACTGA
ORF Protein Sequence MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0296-Ab Anti-ACP1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0296-Ag ACP1 protein
    ORF Viral Vector pGMLP000524 Human ACP1 Lentivirus plasmid
    ORF Viral Vector pGMAP000201 Human ACP1 Adenovirus plasmid
    ORF Viral Vector vGMLP000524 Human ACP1 Lentivirus particle
    ORF Viral Vector vGMAP000201 Human ACP1 Adenovirus particle


    Target information

    Target ID GM-IP0296
    Target Name ACP1
    Gene ID 52, 11431, 721397, 24161, 101092352, 606814, 280977, 100057408
    Gene Symbol and Synonyms 4632432E04Rik,Acp-1,ACP1,HAAP,Lmptp,LMW-PTP,LMWPTP
    Uniprot Accession P24666
    Uniprot Entry Name PPAC_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000143727
    Target Classification Not Available

    The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.