Human NEDD9/CAS-L/CASL ORF/cDNA clone-Adenovirus plasmid (BC020686)
Cat. No.: pGMAP000291
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human NEDD9/CAS-L/CASL adenoviral expression plasmid for NEDD9 adenovirus packaging, NEDD9 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
NEDD9/CAS-L products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP000291 |
| Gene Name | NEDD9 |
| Accession Number | BC020686 |
| Gene ID | 4739 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 525 bp |
| Gene Alias | CAS-L,CASL,dJ49G10.2,dJ761I2.1,HEF1 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGAAGTATAAGAATCTTATGGCAAGGGCCTTATATGACAATGTCCCAGAGTGTGCCGAGGAACTGGCCTTTCGCAAGGGAGACATCCTGACCGTCATAGAGCAGAACACAGGGGGACTGGAAGGATGGTGGCTGTGCTCGTTACACGGTCGGCAAGGCATTGTCCCAGGCAACCGGGTGAAGCTTCTGATTGGTCCCATGCAGGAGACTGCCTCCAGTCACGAGCAGCCTGCCTCTGGACTGATGCAGCAGACCTTTGGCCAACAGAAGCTCTATCAAGTGCCAAACCCACAGGCTGCTCCCCGAGACACCATCTACCAAGTGCCACCTTCCTACCAAAATCAGGGAATTTACCAAGTCCCCACTGGCCACGGCACCCAAGAACAAGAGGTATATCAGGTGCCACCATCAGTGCAGAGAAGCATTGGGGGAACCAGTGGGCCCCACGTGGGTAAAAAGGTGTTCCAGAGAGATGGGCAAGTGTCCTATTTCTTAGTGAGAGCCTCTAAACAAACCAGCTTGTGA |
| ORF Protein Sequence | MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVFQRDGQVSYFLVRASKQTSL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T42890-Ab | Anti-CASL/ NEDD9/ CAS-L monoclonal antibody |
| Target Antigen | GM-Tg-g-T42890-Ag | NEDD9 VLP (virus-like particle) |
| ORF Viral Vector | pGMAP000291 | Human NEDD9 Adenovirus plasmid |
| ORF Viral Vector | vGMAP000291 | Human NEDD9 Adenovirus particle |
Target information
| Target ID | GM-T42890 |
| Target Name | NEDD9 |
| Gene ID | 4739, 18003, 699359, 291044, 101091446, 488220, 504967, 100063890 |
| Gene Symbol and Synonyms | CAS-L,CAS2,CASL,CASS2,HEF1,MEF1,Nedd-9,NEDD9,p105 |
| Uniprot Accession | Q14511 |
| Uniprot Entry Name | CASL_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | Cancer |
| Gene Ensembl | ENSG00000111859 |
| Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protein that acts as a scaffold to regulate signaling complexes important in cell attachment, migration and invasion as well as apoptosis and the cell cycle. This protein has also been reported to have a role in cancer metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


