Human NEDD9/CAS-L/CASL ORF/cDNA clone-Adenovirus plasmid (BC020686)

Cat. No.: pGMAP000291
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NEDD9/CAS-L/CASL adenoviral expression plasmid for NEDD9 adenovirus packaging, NEDD9 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to NEDD9/CAS-L products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000291
Gene Name NEDD9
Accession Number BC020686
Gene ID 4739
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 525 bp
Gene Alias CAS-L,CASL,dJ49G10.2,dJ761I2.1,HEF1
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAAGTATAAGAATCTTATGGCAAGGGCCTTATATGACAATGTCCCAGAGTGTGCCGAGGAACTGGCCTTTCGCAAGGGAGACATCCTGACCGTCATAGAGCAGAACACAGGGGGACTGGAAGGATGGTGGCTGTGCTCGTTACACGGTCGGCAAGGCATTGTCCCAGGCAACCGGGTGAAGCTTCTGATTGGTCCCATGCAGGAGACTGCCTCCAGTCACGAGCAGCCTGCCTCTGGACTGATGCAGCAGACCTTTGGCCAACAGAAGCTCTATCAAGTGCCAAACCCACAGGCTGCTCCCCGAGACACCATCTACCAAGTGCCACCTTCCTACCAAAATCAGGGAATTTACCAAGTCCCCACTGGCCACGGCACCCAAGAACAAGAGGTATATCAGGTGCCACCATCAGTGCAGAGAAGCATTGGGGGAACCAGTGGGCCCCACGTGGGTAAAAAGGTGTTCCAGAGAGATGGGCAAGTGTCCTATTTCTTAGTGAGAGCCTCTAAACAAACCAGCTTGTGA
ORF Protein Sequence MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVFQRDGQVSYFLVRASKQTSL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T42890-Ab Anti-CASL/ NEDD9/ CAS-L monoclonal antibody
    Target Antigen GM-Tg-g-T42890-Ag NEDD9 VLP (virus-like particle)
    ORF Viral Vector pGMAP000291 Human NEDD9 Adenovirus plasmid
    ORF Viral Vector vGMAP000291 Human NEDD9 Adenovirus particle


    Target information

    Target ID GM-T42890
    Target Name NEDD9
    Gene ID 4739, 18003, 699359, 291044, 101091446, 488220, 504967, 100063890
    Gene Symbol and Synonyms CAS-L,CAS2,CASL,CASS2,HEF1,MEF1,Nedd-9,NEDD9,p105
    Uniprot Accession Q14511
    Uniprot Entry Name CASL_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000111859
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protein that acts as a scaffold to regulate signaling complexes important in cell attachment, migration and invasion as well as apoptosis and the cell cycle. This protein has also been reported to have a role in cancer metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.