Human UBAC2 ORF/cDNA clone-Adenovirus plasmid (BC121139)

Cat. No.: pGMAP000462
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human UBAC2/ adenoviral expression plasmid for UBAC2 adenovirus packaging, UBAC2 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to UBAC2/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000462
Gene Name UBAC2
Accession Number BC121139
Gene ID 337867
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 696 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGTATTTCTTTGGCATCACTGCAGCTAGTAATTTGCCTTCTGGATTCCTGGCACCTGTGTTTGCTCTGTTTGTACCATTTTACTGCTCCATACCAAGAGTCCAAGTGGCACAAATTCTGGGTCCGTTGTCCATCACAAACAAGACATTGATTTATATATTGGGACTGCAGCTTTTCACCTCTGGTTCCTACATCTGGATTGTAGCCATAAGTGGACTTATGTCCGGTCTGTGCTACGACAGCAAAATGTTCCAGGTGCATCAGGTGCTCTGCATCCCCAGCTGGATGGCAAAATTCTTTTCTTGGACACTTGAACCCATCTTCTCTTCTTCAGAACCCACCAGCGAAGCCAGAATTGGGATGGGAGCCACGCTGGACATCCAGAGACAGCAGAGAATGGAGCTGCTGGACCGGCAGCTGATGTTCTCTCAGTTTGCACAAGGGAGGCGACAGAGACAGCAGCAGGGAGGAATGATCAATTGGAATCGTCTTTTTCCTCCTTTACGTCAGCGACAAAACGTAAACTATCAGGGCGGTCGGCAGTCTGAGCCAGCAGCGCCCCCTCTAGAAGTTTCTGAGGAACAGGTCGCCCGGCTCATGGAGATGGGATTTTCCAGAGGTGATGCTTTGGAAGCCCTGAGAGCTTCAAACAATGACCTCAATGTCGCCACCAACTTCCTGCTGCAGCACTGA
ORF Protein Sequence MQYFFGITAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2219-Ab Anti-UBAC2 monoclonal antibody
    Target Antigen GM-Tg-g-IP2219-Ag UBAC2 protein
    ORF Viral Vector pGMAP000462 Human UBAC2 Adenovirus plasmid
    ORF Viral Vector vGMAP000462 Human UBAC2 Adenovirus particle


    Target information

    Target ID GM-IP2219
    Target Name UBAC2
    Gene ID 337867, 68889, 703484, 361094, 101080352, 608309, 100125312, 100061123
    Gene Symbol and Synonyms 1190008A14Rik,PHGDHL1,UBAC2
    Uniprot Accession Q8NBM4
    Uniprot Entry Name UBAC2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000134882
    Target Classification Not Available

    Involved in negative regulation of canonical Wnt signaling pathway and negative regulation of retrograde protein transport, ER to cytosol. Acts upstream of or within protein localization to endoplasmic reticulum. Located in endoplasmic reticulum. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.