Human UBAC2 ORF/cDNA clone-Adenovirus particle (BC121139)

Cat. No.: vGMAP000462

Pre-made Human UBAC2/ Adenovirus for UBAC2 overexpression in-vitro and in-vivo. The UBAC2 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified UBAC2-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to UBAC2/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000462 Human UBAC2 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000462
Gene Name UBAC2
Accession Number BC121139
Gene ID 337867
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 696 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGTATTTCTTTGGCATCACTGCAGCTAGTAATTTGCCTTCTGGATTCCTGGCACCTGTGTTTGCTCTGTTTGTACCATTTTACTGCTCCATACCAAGAGTCCAAGTGGCACAAATTCTGGGTCCGTTGTCCATCACAAACAAGACATTGATTTATATATTGGGACTGCAGCTTTTCACCTCTGGTTCCTACATCTGGATTGTAGCCATAAGTGGACTTATGTCCGGTCTGTGCTACGACAGCAAAATGTTCCAGGTGCATCAGGTGCTCTGCATCCCCAGCTGGATGGCAAAATTCTTTTCTTGGACACTTGAACCCATCTTCTCTTCTTCAGAACCCACCAGCGAAGCCAGAATTGGGATGGGAGCCACGCTGGACATCCAGAGACAGCAGAGAATGGAGCTGCTGGACCGGCAGCTGATGTTCTCTCAGTTTGCACAAGGGAGGCGACAGAGACAGCAGCAGGGAGGAATGATCAATTGGAATCGTCTTTTTCCTCCTTTACGTCAGCGACAAAACGTAAACTATCAGGGCGGTCGGCAGTCTGAGCCAGCAGCGCCCCCTCTAGAAGTTTCTGAGGAACAGGTCGCCCGGCTCATGGAGATGGGATTTTCCAGAGGTGATGCTTTGGAAGCCCTGAGAGCTTCAAACAATGACCTCAATGTCGCCACCAACTTCCTGCTGCAGCACTGA
ORF Protein Sequence MQYFFGITAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2219-Ab Anti-UBAC2 monoclonal antibody
    Target Antigen GM-Tg-g-IP2219-Ag UBAC2 protein
    ORF Viral Vector pGMAP000462 Human UBAC2 Adenovirus plasmid
    ORF Viral Vector vGMAP000462 Human UBAC2 Adenovirus particle


    Target information

    Target ID GM-IP2219
    Target Name UBAC2
    Gene ID 337867, 68889, 703484, 361094, 101080352, 608309, 100125312, 100061123
    Gene Symbol and Synonyms 1190008A14Rik,PHGDHL1,UBAC2
    Uniprot Accession Q8NBM4
    Uniprot Entry Name UBAC2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000134882
    Target Classification Not Available

    Involved in negative regulation of canonical Wnt signaling pathway and negative regulation of retrograde protein transport, ER to cytosol. Acts upstream of or within protein localization to endoplasmic reticulum. Located in endoplasmic reticulum. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.