Human RCN1/HEL-S-84/PIG20 ORF/cDNA clone-Lentivirus plasmid (NM_002901.2)
Cat. No.: pGMLV000272
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human RCN1/HEL-S-84/PIG20 Lentiviral expression plasmid for RCN1 lentivirus packaging, RCN1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
RCN1/HEL-S-84 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV000272 |
Gene Name | RCN1 |
Accession Number | NM_002901.2 |
Gene ID | 5954 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 996 bp |
Gene Alias | HEL-S-84,PIG20,RCAL,RCN |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCGCGCGGTGGCCGCGGCCGCCGCCTGGGGTTAGCCCTGGGGCTGCTGCTGGCGCTGGTGCTGGCGCCGCGGGTTCTGCGGGCCAAGCCCACGGTGCGCAAAGAGCGCGTGGTGCGGCCCGACTCGGAGCTGGGCGAGCGGCCCCCTGAGGACAACCAGAGCTTCCAGTACGACCACGAGGCCTTCCTGGGCAAGGAGGACTCCAAGACCTTCGACCAGCTCACCCCGGACGAGAGCAAGGAGAGGCTAGGGAAGATTGTTGATCGAATCGACAATGATGGGGATGGCTTTGTCACTACTGAGGAGCTGAAAACCTGGATCAAACGGGTGCAGAAAAGATACATCTTTGATAATGTCGCCAAAGTCTGGAAGGATTATGATAGGGACAAGGATGATAAAATTTCCTGGGAAGAATACAAACAAGCCACCTATGGTTACTACCTAGGAAACCCCGCAGAGTTTCATGATTCTTCAGATCATCACACCTTTAAAAAGATGCTGCCACGTGATGAGAGAAGATTCAAAGCTGCAGACCTCAATGGTGACCTGACAGCTACTCGGGAGGAGTTCACTGCCTTTCTGCATCCTGAAGAGTTTGAACATATGAAGGAAATTGTGGTTTTGGAAACCCTGGAGGACATCGACAAGAACGGGGATGGGTTTGTGGATCAGGATGAGTATATTGCGGATATGTTTTCCCATGAGGAGAATGGCCCTGAGCCAGACTGGGTTTTATCAGAACGGGAGCAGTTTAACGAATTCCGGGATCTGAACAAGGACGGGAAGTTAGACAAAGATGAGATTCGCCACTGGATCCTCCCTCAAGATTATGATCATGCACAGGCTGAGGCCAGGCATCTGGTATATGAATCAGACAAAAACAAGGATGAGAAGCTAACTAAAGAGGAAATATTGGAGAACTGGAACATGTTTGTCGGAAGCCAAGCTACCAATTACGGGGAAGATCTCACAAAAAATCATGATGAGCTTTGA |
ORF Protein Sequence | MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0442-Ab | Anti-RCN1/ HEL-S-84/ PIG20 functional antibody |
Target Antigen | GM-Tg-g-SE0442-Ag | RCN1 protein |
ORF Viral Vector | pGMLV000272 | Human RCN1 Lentivirus plasmid |
ORF Viral Vector | pGMAP000573 | Human RCN1 Adenovirus plasmid |
ORF Viral Vector | vGMLV000272 | Human RCN1 Lentivirus particle |
ORF Viral Vector | vGMAP000573 | Human RCN1 Adenovirus particle |
Target information
Target ID | GM-SE0442 |
Target Name | RCN1 |
Gene ID | 5954, 19672, 696800, 362182, 101088272, 475952, 281445, 100072670 |
Gene Symbol and Synonyms | HEL-S-84,PIG20,RCAL,RCN,RCN1 |
Uniprot Accession | Q15293 |
Uniprot Entry Name | RCN1_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000049449 |
Target Classification | Not Available |
Reticulocalbin 1 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. High conservation of amino acid residues outside of these motifs, in comparison to mouse reticulocalbin, is consistent with a possible biochemical function besides that of calcium binding. In human endothelial and prostate cancer cell lines this protein localizes to the plasma membrane.[provided by RefSeq, Jan 2009]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.