Human BET1L/BET1L1/GOLIM3 ORF/cDNA clone-Lentivirus plasmid (NM_016526)
Cat. No.: pGMLV000565
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human BET1L/BET1L1/GOLIM3 Lentiviral expression plasmid for BET1L lentivirus packaging, BET1L lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
BET1L/BET1L1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV000565 |
| Gene Name | BET1L |
| Accession Number | NM_016526 |
| Gene ID | 51272 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 309 bp |
| Gene Alias | BET1L1,GOLIM3,GS15,HSPC197 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGGACTGGGCTCGGGCTCAGAGCCCGGGCGCTGTGGAAGAGATTCTAGACCGGGAGAACAAGCGAATGGCTGACAGCCTGGCCTCCAAAGTCACCAGGCTCAAATCGCTCGCCCTGGACATCGATAGGGATGCAGAGGATCAGAACCGGTACCTGGATGGCATGGTAAGGGCCCACGGTGTGCGTGTATCAGTGCCCTGCCCTAGCACTACCTGCTGCAGAGCCTGCAGTGTCTCCTTCAGCACTGGTGCGGGTGGGTGGTCAAATCACCACTTCTGTGTGATCTTGCTGGGATTCCTCCCTTAG |
| ORF Protein Sequence | MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAHGVRVSVPCPSTTCCRACSVSFSTGAGGWSNHHFCVILLGFLP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0419-Ab | Anti-BET1L monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0419-Ag | BET1L protein |
| ORF Viral Vector | pGMLV000565 | Human BET1L Lentivirus plasmid |
| ORF Viral Vector | vGMLV000565 | Human BET1L Lentivirus particle |
Target information
| Target ID | GM-IP0419 |
| Target Name | BET1L |
| Gene ID | 51272, 54399, 696599, 54400, 101081001, 483393, 509758 |
| Gene Symbol and Synonyms | 2610021K23Rik,Bet1,BET1L,BET1L1,GOLIM3,GS15,HSPC197 |
| Uniprot Accession | Q9NYM9 |
| Uniprot Entry Name | BET1L_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000177951 |
| Target Classification | Not Available |
Enables SNAP receptor activity. Involved in regulation of retrograde vesicle-mediated transport, Golgi to ER and retrograde transport, endosome to Golgi. Located in Golgi apparatus and endosome. Implicated in uterine fibroid. Biomarker of endometrial adenocarcinoma. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


