Human BET1L/BET1L1/GOLIM3 ORF/cDNA clone-Lentivirus particle (NM_016526)

Cat. No.: vGMLV000565

Pre-made Human BET1L/BET1L1/GOLIM3 Lentiviral expression plasmid for BET1L lentivirus packaging, BET1L lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to BET1L/BET1L1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV000565 Human BET1L Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV000565
Gene Name BET1L
Accession Number NM_016526
Gene ID 51272
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 309 bp
Gene Alias BET1L1,GOLIM3,GS15,HSPC197
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGACTGGGCTCGGGCTCAGAGCCCGGGCGCTGTGGAAGAGATTCTAGACCGGGAGAACAAGCGAATGGCTGACAGCCTGGCCTCCAAAGTCACCAGGCTCAAATCGCTCGCCCTGGACATCGATAGGGATGCAGAGGATCAGAACCGGTACCTGGATGGCATGGTAAGGGCCCACGGTGTGCGTGTATCAGTGCCCTGCCCTAGCACTACCTGCTGCAGAGCCTGCAGTGTCTCCTTCAGCACTGGTGCGGGTGGGTGGTCAAATCACCACTTCTGTGTGATCTTGCTGGGATTCCTCCCTTAG
ORF Protein Sequence MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAHGVRVSVPCPSTTCCRACSVSFSTGAGGWSNHHFCVILLGFLP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0419-Ab Anti-BET1L monoclonal antibody
    Target Antigen GM-Tg-g-IP0419-Ag BET1L protein
    ORF Viral Vector pGMLV000565 Human BET1L Lentivirus plasmid
    ORF Viral Vector vGMLV000565 Human BET1L Lentivirus particle


    Target information

    Target ID GM-IP0419
    Target Name BET1L
    Gene ID 51272, 54399, 696599, 54400, 101081001, 483393, 509758
    Gene Symbol and Synonyms 2610021K23Rik,Bet1,BET1L,BET1L1,GOLIM3,GS15,HSPC197
    Uniprot Accession Q9NYM9
    Uniprot Entry Name BET1L_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000177951
    Target Classification Not Available

    Enables SNAP receptor activity. Involved in regulation of retrograde vesicle-mediated transport, Golgi to ER and retrograde transport, endosome to Golgi. Located in Golgi apparatus and endosome. Implicated in uterine fibroid. Biomarker of endometrial adenocarcinoma. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.