Human BOK/BCL2L9/BOKL ORF/cDNA clone-Lentivirus plasmid (NM_032515.5)

Cat. No.: pGMLV000687
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BOK/BCL2L9/BOKL Lentiviral expression plasmid for BOK lentivirus packaging, BOK lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to BOK/BCL2L9 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $459.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000687
Gene Name BOK
Accession Number NM_032515.5
Gene ID 666
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 639 bp
Gene Alias BCL2L9,BOKL
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGTGCTGCGGCGCTCCTCGGTCTTCGCCGCCGAGATCATGGACGCCTTTGACCGCTCGCCCACAGACAAGGAGCTGGTGGCCCAGGCCAAGGCGCTGGGCCGGGAGTACGTGCACGCGCGGCTGCTGCGCGCCGGCCTCTCCTGGAGCGCGCCCGAGCGTGCCGCGCCGGTCCCGGGACGCCTGGCTGAGGTGTGCGCGGTGCTGCTGCGCCTGGGCGATGAGCTGGAGATGATCCGGCCCAGCGTCTACCGCAACGTGGCGCGTCAGCTGCACATCTCCCTGCAGTCTGAGCCTGTGGTGACCGATGCGTTCCTGGCCGTGGCTGGCCACATCTTCTCTGCAGGCATCACGTGGGGCAAGGTGGTGTCCCTGTATGCGGTGGCCGCGGGGCTGGCCGTGGACTGTGTGAGGCAGGCCCAGCCTGCCATGGTCCACGCCCTCGTGGACTGCCTGGGGGAGTTCGTGCGCAAGACCCTGGCAACCTGGCTGCGGAGACGCGGCGGATGGACTGATGTCCTCAAGTGTGTGGTCAGCACAGACCCTGGCCTCCGCTCCCACTGGCTGGTGGCTGCACTCTGCAGCTTCGGCCGCTTCCTGAAGGCTGCCTTCTTCGTGCTGCTGCCAGAGAGATGA
ORF Protein Sequence MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0429-Ab Anti-BOK monoclonal antibody
    Target Antigen GM-Tg-g-IP0429-Ag BOK protein
    ORF Viral Vector pGMLV000687 Human BOK Lentivirus plasmid
    ORF Viral Vector vGMLV000687 Human BOK Lentivirus particle


    Target information

    Target ID GM-IP0429
    Target Name BOK
    Gene ID 666, 51800, 701430, 29884, 768266, 100855929, 504851, 100147141
    Gene Symbol and Synonyms BCL2L9,BOK,Bok-BH3,BOKL,matador,mtd
    Uniprot Accession Q9UMX3
    Uniprot Entry Name BOK_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000176720
    Target Classification Not Available

    The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family. [provided by RefSeq, Sep 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.