Human BOK/BCL2L9/BOKL ORF/cDNA clone-Lentivirus particle (NM_032515.5)
Cat. No.: vGMLV000687
Pre-made Human BOK/BCL2L9/BOKL Lentiviral expression plasmid for BOK lentivirus packaging, BOK lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
BOK/BCL2L9 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV000687 | Human BOK Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV000687 |
| Gene Name | BOK |
| Accession Number | NM_032515.5 |
| Gene ID | 666 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 639 bp |
| Gene Alias | BCL2L9,BOKL |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGAGGTGCTGCGGCGCTCCTCGGTCTTCGCCGCCGAGATCATGGACGCCTTTGACCGCTCGCCCACAGACAAGGAGCTGGTGGCCCAGGCCAAGGCGCTGGGCCGGGAGTACGTGCACGCGCGGCTGCTGCGCGCCGGCCTCTCCTGGAGCGCGCCCGAGCGTGCCGCGCCGGTCCCGGGACGCCTGGCTGAGGTGTGCGCGGTGCTGCTGCGCCTGGGCGATGAGCTGGAGATGATCCGGCCCAGCGTCTACCGCAACGTGGCGCGTCAGCTGCACATCTCCCTGCAGTCTGAGCCTGTGGTGACCGATGCGTTCCTGGCCGTGGCTGGCCACATCTTCTCTGCAGGCATCACGTGGGGCAAGGTGGTGTCCCTGTATGCGGTGGCCGCGGGGCTGGCCGTGGACTGTGTGAGGCAGGCCCAGCCTGCCATGGTCCACGCCCTCGTGGACTGCCTGGGGGAGTTCGTGCGCAAGACCCTGGCAACCTGGCTGCGGAGACGCGGCGGATGGACTGATGTCCTCAAGTGTGTGGTCAGCACAGACCCTGGCCTCCGCTCCCACTGGCTGGTGGCTGCACTCTGCAGCTTCGGCCGCTTCCTGAAGGCTGCCTTCTTCGTGCTGCTGCCAGAGAGATGA |
| ORF Protein Sequence | MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0429-Ab | Anti-BOK monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0429-Ag | BOK protein |
| ORF Viral Vector | pGMLV000687 | Human BOK Lentivirus plasmid |
| ORF Viral Vector | vGMLV000687 | Human BOK Lentivirus particle |
Target information
| Target ID | GM-IP0429 |
| Target Name | BOK |
| Gene ID | 666, 51800, 701430, 29884, 768266, 100855929, 504851, 100147141 |
| Gene Symbol and Synonyms | BCL2L9,BOK,Bok-BH3,BOKL,matador,mtd |
| Uniprot Accession | Q9UMX3 |
| Uniprot Entry Name | BOK_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000176720 |
| Target Classification | Not Available |
The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family. [provided by RefSeq, Sep 2011]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


