Human CD40/Bp50/CDW40 ORF/cDNA clone-Lentivirus plasmid (NM_001250.6)

Cat. No.: pGMLV000961
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD40/Bp50/CDW40 Lentiviral expression plasmid for CD40 lentivirus packaging, CD40 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CD40/Bp50 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $508.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000961
Gene Name CD40
Accession Number NM_001250.6
Gene ID 958
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 834 bp
Gene Alias Bp50,CDW40,p50,TNFRSF5
Fluorescent Reporter mCherry
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTTCGTCTGCCTCTGCAGTGCGTCCTCTGGGGCTGCTTGCTGACCGCTGTCCATCCAGAACCACCCACTGCATGCAGAGAAAAACAGTACCTAATAAACAGTCAGTGCTGTTCTTTGTGCCAGCCAGGACAGAAACTGGTGAGTGACTGCACAGAGTTCACTGAAACGGAATGCCTTCCTTGCGGTGAAAGCGAATTCCTAGACACCTGGAACAGAGAGACACACTGCCACCAGCACAAATACTGCGACCCCAACCTAGGGCTTCGGGTCCAGCAGAAGGGCACCTCAGAAACAGACACCATCTGCACCTGTGAAGAAGGCTGGCACTGTACGAGTGAGGCCTGTGAGAGCTGTGTCCTGCACCGCTCATGCTCGCCCGGCTTTGGGGTCAAGCAGATTGCTACAGGGGTTTCTGATACCATCTGCGAGCCCTGCCCAGTCGGCTTCTTCTCCAATGTGTCATCTGCTTTCGAAAAATGTCACCCTTGGACAAGCTGTGAGACCAAAGACCTGGTTGTGCAACAGGCAGGCACAAACAAGACTGATGTTGTCTGTGGTCCCCAGGATCGGCTGAGAGCCCTGGTGGTGATCCCCATCATCTTCGGGATCCTGTTTGCCATCCTCTTGGTGCTGGTCTTTATCAAAAAGGTGGCCAAGAAGCCAACCAATAAGGCCCCCCACCCCAAGCAGGAACCCCAGGAGATCAATTTTCCCGACGATCTTCCTGGCTCCAACACTGCTGCTCCAGTGCAGGAGACTTTACATGGATGCCAACCGGTCACCCAGGAGGATGGCAAAGAGAGTCGCATCTCAGTGCAGGAGAGACAGTGA
ORF Protein Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-471 Pre-Made Ravagalimab biosimilar, Whole mAb, Anti-CD40 Antibody: Anti-p50/Bp50/CDW40/TNFRSF5 therapeutic antibody
    Biosimilar GMP-Bios-ab-609 Pre-Made Vanalimab biosimilar, Whole mAb, Anti-CD40 Antibody: Anti-p50/Bp50/CDW40/TNFRSF5 therapeutic antibody
    Biosimilar GMP-Bios-ab-073 Pre-Made Bleselumab biosimilar, Whole mAb, Anti-CD40 Antibody: Anti-p50/Bp50/CDW40/TNFRSF5 therapeutic antibody
    Biosimilar GMP-Bios-ab-325 Pre-Made Lucatumumab biosimilar, Whole mAb, Anti-CD40 Antibody: Anti-p50/Bp50/CDW40/TNFRSF5 therapeutic antibody
    Biosimilar GMP-Bios-ab-351 Pre-Made Mitazalimab biosimilar, Whole mAb, Anti-CD40 Antibody: Anti-p50/Bp50/CDW40/TNFRSF5 therapeutic antibody
    Biosimilar GMP-Bios-ab-242 Pre-Made Giloralimab biosimilar, Whole mAb, Anti-CD40 Antibody: Anti-p50/Bp50/CDW40/TNFRSF5 therapeutic antibody
    Biosimilar GMP-Bios-ab-511 Pre-Made Selicrelumab biosimilar, Whole mAb, Anti-CD40 Antibody: Anti-p50/Bp50/CDW40/TNFRSF5 therapeutic antibody
    Biosimilar GMP-Bios-ab-701 Pre-Made Tecaginlimab biosimilar, Whole mAb, Anti-CD40;TNFRSF9/CD137 Antibody: Anti-p50/Bp50/CDW40/TNFRSF5;ILA/4-1BB/CDw137 therapeutic antibody
    Biosimilar GMP-Bios-ab-128 Pre-Made Dacetuzumab biosimilar, Whole mAb, Anti-CD40 Antibody: Anti-p50/Bp50/CDW40/TNFRSF5 therapeutic antibody
    Biosimilar GMP-Bios-INN-1019 Pre-Made Teneliximab Biosimilar, Whole Mab, Anti-Cd40 Antibody: Anti-Bp50/CDW40/TNFRSF5/p50 therapeutic antibody
    Biosimilar GMP-Bios-ab-529 Pre-Made Sotigalimab biosimilar, Whole mAb, Anti-CD40 Antibody: Anti-p50/Bp50/CDW40/TNFRSF5 therapeutic antibody
    Biosimilar GMP-Bios-ab-280 Pre-Made Iscalimab biosimilar, Whole mAb, Anti-CD40 Antibody: Anti-p50/Bp50/CDW40/TNFRSF5 therapeutic antibody
    Target Antibody GM-Tg-g-T45758-Ab Anti-TNR5/ CD40/ Bp50 monoclonal antibody
    Target Antigen GM-Tg-g-T45758-Ag CD40 VLP (virus-like particle)
    ORF Viral Vector pGMLV000961 Human CD40 Lentivirus plasmid
    ORF Viral Vector pGMAP000160 Human CD40 Adenovirus plasmid
    ORF Viral Vector pGMAP000438 Human CD40 Adenovirus plasmid
    ORF Viral Vector vGMLV000961 Human CD40 Lentivirus particle
    ORF Viral Vector vGMAP000160 Human CD40 Adenovirus particle
    ORF Viral Vector vGMAP000438 Human CD40 Adenovirus particle


    Target information

    Target ID GM-T45758
    Target Name CD40
    Gene ID 958, 21939, 707749, 171369, 101085363, 403469, 286849, 100034049
    Gene Symbol and Synonyms Bp50,CD40,CDW40,GP39,HIGM1,IGM,IMD3,p50,T-BAM,TNFRSF5,TRAP
    Uniprot Accession P25942
    Uniprot Entry Name TNR5_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease Cancer
    Gene Ensembl ENSG00000101017
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)

    This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Nov 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.