Human SKP2/FBL1/FBXL1 ORF/cDNA clone-Lentivirus plasmid (NM_032637.3)

Cat. No.: pGMLV001015
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SKP2/FBL1/FBXL1 Lentiviral expression plasmid for SKP2 lentivirus packaging, SKP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SKP2/FBL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $645.24
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001015
Gene Name SKP2
Accession Number NM_032637.3
Gene ID 6502
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1233 bp
Gene Alias FBL1,FBXL1,FLB1,p45
Fluorescent Reporter mCherry
Mammalian Cell Selection Blasticidin (BSD)
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCACAGGAAGCACCTCCAGGAGATTCCAGACCTGAGTAGCAACGTTGCCACCAGCTTCACGTGGGGATGGGATTCCAGCAAGACTTCTGAACTGCTGTCAGGCATGGGGGTCTCCGCCCTGGAGAAAGAGGAGCCCGACAGTGAGAACATCCCCCAGGAACTGCTCTCAAACCTGGGCCACCCGGAGAGCCCCCCACGGAAACGGCTGAAGAGCAAAGGGAGTGACAAAGACTTTGTGATTGTCCGCAGGCCTAAGCTAAATCGAGAGAACTTTCCAGGTGTTTCATGGGACTCCCTTCCGGATGAGCTGCTCTTGGGAATCTTTTCCTGTCTGTGCCTCCCTGAGCTGCTAAAGGTCTCTGGTGTTTGTAAGAGGTGGTATCGCCTAGCGTCTGATGAGTCTCTATGGCAGACCTTAGACCTCACAGGTAAAAATCTGCACCCGGATGTGACTGGTCGGTTGCTGTCTCAAGGGGTGATTGCCTTCCGCTGCCCACGATCATTTATGGACCAACCATTGGCTGAACATTTCAGCCCTTTTCGTGTACAGCACATGGACCTATCGAACTCAGTTATAGAAGTGTCCACCCTCCACGGCATACTGTCTCAGTGTTCCAAGTTGCAGAATCTAAGCCTGGAAGGCCTGCGGCTTTCGGATCCCATTGTCAATACTCTCGCAAAAAACTCAAATTTAGTGCGACTTAACCTTTCTGGGTGTTCTGGATTCTCTGAATTTGCCCTGCAGACTTTGCTAAGCAGCTGTTCCAGACTGGATGAGCTGAACCTCTCCTGGTGTTTTGATTTCACTGAAAAGCATGTACAGGTGGCTGTTGCGCATGTGTCAGAGACCATCACCCAGCTGAATCTTAGCGGCTACAGAAAGAATCTCCAGAAATCAGATCTCTCTACTTTAGTTAGAAGATGCCCCAATCTTGTCCATCTAGACTTAAGTGATAGTGTCATGCTAAAGAATGACTGCTTTCAGGAATTTTTCCAGCTCAACTACCTCCAACACCTATCACTCAGTCGGTGCTATGATATAATACCTGAAACTTTACTATTAGTGACAAGAGCTGGGGTTAGGATCCGGTTGGACTCTGACATCGGATGCCCTCAAACATACAGAACTTCCAAACTCAAGTCCAGCCATAAGCTATTTTGCCAACATGTCAGAGTAATCTGTATTTTTGTATGTGATTTCTACTTTTATAGACTTGTTTTAAAACAATAA
ORF Protein Sequence MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLLVTRAGVRIRLDSDIGCPQTYRTSKLKSSHKLFCQHVRVICIFVCDFYFYRLVLKQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T80306-Ab Anti-SKP2 monoclonal antibody
    Target Antigen GM-Tg-g-T80306-Ag SKP2 protein
    ORF Viral Vector pGMLP000485 Human SKP2 Lentivirus plasmid
    ORF Viral Vector pGMLV001015 Human SKP2 Lentivirus plasmid
    ORF Viral Vector pGMAP000324 Human SKP2 Adenovirus plasmid
    ORF Viral Vector vGMLP000485 Human SKP2 Lentivirus particle
    ORF Viral Vector vGMLV001015 Human SKP2 Lentivirus particle
    ORF Viral Vector vGMAP000324 Human SKP2 Adenovirus particle


    Target information

    Target ID GM-T80306
    Target Name SKP2
    Gene ID 6502, 27401, 700617, 294790, 101099275, 489228, 519018, 100053697
    Gene Symbol and Synonyms 4930500A04Rik,FBL1,FBXL1,FLB1,FWD1,p45,RGD1562456,SKP2
    Uniprot Accession Q13309
    Uniprot Entry Name SKP2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000145604
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class; in addition to an F-box, this protein contains 10 tandem leucine-rich repeats. This protein is an essential element of the cyclin A-CDK2 S-phase kinase. It specifically recognizes phosphorylated cyclin-dependent kinase inhibitor 1B (CDKN1B, also referred to as p27 or KIP1) predominantly in S phase and interacts with S-phase kinase-associated protein 1 (SKP1 or p19). In addition, this gene is established as a protooncogene causally involved in the pathogenesis of lymphomas. Alternative splicing of this gene generates three transcript variants encoding different isoforms. [provided by RefSeq, Jul 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.