Human SKP2/FBL1/FBXL1 ORF/cDNA clone-Adenovirus particle (BC001441)
Cat. No.: vGMAP000324
Pre-made Human SKP2/FBL1/FBXL1 Adenovirus for SKP2 overexpression in-vitro and in-vivo. The SKP2 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified SKP2-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
SKP2/FBL1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000324 | Human SKP2 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000324 |
| Gene Name | SKP2 |
| Accession Number | BC001441 |
| Gene ID | 6502 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 1233 bp |
| Gene Alias | FBL1,FBXL1,FLB1,MGC1366 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCACAGGAAGCACCTCCAGGAGATTCCAGACCTGAGTAGCAACGTTGCCACCAGCTTCACGTGGGGATGGGATTCCAGCAAGACTTCTGAACTGCTGTCAGGCATGGGGGTCTCCGCCCTGGAGAAAGAGGAGCCCGACAGTGAGAACATCCCCCAGGAACTGCTCTCAAACCTGGGCCACCCGGAGAGCCCCCCACGGAAACGGCTGAAGAGCAAAGGGAGTGACAAAGACTTTGTGATTGTCCGCAGGCCTAAGCTAAATCGAGAGAACTTTCCAGGTGTTTCATGGGACTCCCTTCCGGATGAGCTGCTCTTGGGAATCTTTTCCTGTCTGTGCCTCCCTGAGCTGCTAAAGGTCTCTGGTGTTTGTAAGAGGTGGTATCGCCTAGCGTCTGATGAGTCTCTATGGCAGACCTTAGACCTCACAGGTAAAAATCTGCACCCGGATGTGACTGGTCGGTTGCTGTCTCAAGGGGTGATTGCCTTCCGCTGCCCACGATCATTTATGGACCAACCATTGGCTGAACATTTCAGCCCTTTTCGTGTACAGCACATGGACCTATCGAACTCAGTTATAGAAGTGTCCACCCTCCACGGCATACTGTCTCAGTGTTCCAAGTTGCAGAATCTAAGCCTGGAAGGCCTGCGGCTTTCGGATCCCATTGTCAATACTCTCGCAAAAAACTCAAATTTAGTGCGACTTAACCTTTCTGGGTGTTCTGGATTCTCTGAATTTGCCCTGCAGACTTTGCTAAGCAGCTGTTCCAGACTGGATGAGCTGAACCTCTCCTGGTGTTTTGATTTCACTGAAAAGCATGTACAGGTGGCTGTTGCGCATGTGTCAGAGACCATCACCCAGCTGAATCTTAGCGGCTACAGAAAGAATCTCCAGAAATCAGATCTCTCTACTTTAGTTAGAAGATGCCCCAATCTTGTCCATCTAGACTTAAGTGATAGTGTCATGCTAAAGAATGACTGCTTTCAGGAATTTTTCCAGCTCAACTACCTCCAACACCTATCACTCAGTCGGTGCTATGATATAATACCTGAAACTTTACTATTAGTGACAAGAGCTGGGGTTAGGATCCGGTTGGACTCTGACATCGGATGCCCTCAAACATACAGAACTTCCAAACTCAAGTCCAGCCATAAGCTATTTTGCCAACATGTCAGAGTAATCTGTATTTTTGTATGTGATTTCTACTTTTATAGACTTGTTTTAAAACAATAA |
| ORF Protein Sequence | MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLLVTRAGVRIRLDSDIGCPQTYRTSKLKSSHKLFCQHVRVICIFVCDFYFYRLVLKQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T80306-Ab | Anti-SKP2 monoclonal antibody |
| Target Antigen | GM-Tg-g-T80306-Ag | SKP2 protein |
| ORF Viral Vector | pGMLP000485 | Human SKP2 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001015 | Human SKP2 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000324 | Human SKP2 Adenovirus plasmid |
| ORF Viral Vector | vGMLP000485 | Human SKP2 Lentivirus particle |
| ORF Viral Vector | vGMLV001015 | Human SKP2 Lentivirus particle |
| ORF Viral Vector | vGMAP000324 | Human SKP2 Adenovirus particle |
Target information
| Target ID | GM-T80306 |
| Target Name | SKP2 |
| Gene ID | 6502, 27401, 700617, 294790, 101099275, 489228, 519018, 100053697 |
| Gene Symbol and Synonyms | 4930500A04Rik,FBL1,FBXL1,FLB1,FWD1,p45,RGD1562456,SKP2 |
| Uniprot Accession | Q13309 |
| Uniprot Entry Name | SKP2_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | Cancer |
| Gene Ensembl | ENSG00000145604 |
| Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class; in addition to an F-box, this protein contains 10 tandem leucine-rich repeats. This protein is an essential element of the cyclin A-CDK2 S-phase kinase. It specifically recognizes phosphorylated cyclin-dependent kinase inhibitor 1B (CDKN1B, also referred to as p27 or KIP1) predominantly in S phase and interacts with S-phase kinase-associated protein 1 (SKP1 or p19). In addition, this gene is established as a protooncogene causally involved in the pathogenesis of lymphomas. Alternative splicing of this gene generates three transcript variants encoding different isoforms. [provided by RefSeq, Jul 2011]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


