Human CD63/LAMP-3/ME491 ORF/cDNA clone-Lentivirus plasmid (NM_001780)

Cat. No.: pGMLV001026
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD63/LAMP-3/ME491 Lentiviral expression plasmid for CD63 lentivirus packaging, CD63 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to LAMP/CD63/LAMP-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $479.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001026
Gene Name CD63
Accession Number NM_001780
Gene ID 967
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 717 bp
Gene Alias LAMP-3,ME491,MLA1,OMA81H,TSPAN30
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGTGGAAGGAGGAATGAAATGTGTGAAGTTCTTGCTCTACGTCCTCCTGCTGGCCTTTTGCGCCTGTGCAGTGGGACTGATTGCCGTGGGTGTCGGGGCACAGCTTGTCCTGAGTCAGACCATAATCCAGGGGGCTACCCCTGGCTCTCTGTTGCCAGTGGTCATCATCGCAGTGGGTGTCTTCCTCTTCCTGGTGGCTTTTGTGGGCTGCTGCGGGGCCTGCAAGGAGAACTATTGTCTTATGATCACGTTTGCCATCTTTCTGTCTCTTATCATGTTGGTGGAGGTGGCCGCAGCCATTGCTGGCTATGTGTTTAGAGATAAGGTGATGTCAGAGTTTAATAACAACTTCCGGCAGCAGATGGAGAATTACCCGAAAAACAACCACACTGCTTCGATCCTGGACAGGATGCAGGCAGATTTTAAGTGCTGTGGGGCTGCTAACTACACAGATTGGGAGAAAATCCCTTCCATGTCGAAGAACCGAGTCCCCGACTCCTGCTGCATTAATGTTACTGTGGGCTGTGGGATTAATTTCAACGAGAAGGCGATCCATAAGGAGGGCTGTGTGGAGAAGATTGGGGGCTGGCTGAGGAAAAATGTGCTGGTGGTAGCTGCAGCAGCCCTTGGAATTGCTTTTGTCGAGGTTTTGGGAATTGTCTTTGCCTGCTGCCTCGTGAAGAGTATCAGAAGTGGCTACGAGGTGATGTAG
ORF Protein Sequence MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IO085-Ab Anti-CD63/ LAMP/ LAMP-3 monoclonal antibody
    Target Antigen GM-Tg-g-IO085-Ag LAMP/CD63 VLP (virus-like particle)
    ORF Viral Vector pGMLP002280 Human CD63 Lentivirus plasmid
    ORF Viral Vector pGMLV001022 Human CD63 Lentivirus plasmid
    ORF Viral Vector pGMLV001024 Human CD63 Lentivirus plasmid
    ORF Viral Vector pGMLV001026 Human CD63 Lentivirus plasmid
    ORF Viral Vector pGMLV001475 Human CD63 Lentivirus plasmid
    ORF Viral Vector pGMAAV000550 Human CD63 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMPC000325 Human CD63 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002280 Human CD63 Lentivirus particle
    ORF Viral Vector vGMLV001022 Human CD63 Lentivirus particle
    ORF Viral Vector vGMLV001024 Human CD63 Lentivirus particle
    ORF Viral Vector vGMLV001026 Human CD63 Lentivirus particle
    ORF Viral Vector vGMLV001475 Human CD63 Lentivirus particle
    ORF Viral Vector vGMAAV000550 Human CD63 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-IO085
    Target Name LAMP
    Gene ID 967, 12512, 709828, 29186, 493846, 474391, 404156, 100051450
    Gene Symbol and Synonyms CD63,ME491,MLA1,OMA81H,TSPAN30
    Uniprot Accession P08962
    Uniprot Entry Name CD63_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Cancer
    Gene Ensembl ENSG00000135404
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)

    The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.