Human CD209/CDSIGN/CLEC4L ORF/cDNA clone-Lentivirus plasmid (NM_021155.4)

Cat. No.: pGMLV001037
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD209/CDSIGN/CLEC4L Lentiviral expression plasmid for CD209 lentivirus packaging, CD209 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CD209/CDSIGN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $640.2
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001037
Gene Name CD209
Accession Number NM_021155.4
Gene ID 30835
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1215 bp
Gene Alias CDSIGN,CLEC4L,DC-SIGN,DC-SIGN1
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTGACTCCAAGGAACCAAGACTGCAGCAGCTGGGCCTCCTGGAGGAGGAACAGCTGAGAGGCCTTGGATTCCGACAGACTCGAGGATACAAGAGCTTAGCAGGGTGTCTTGGCCATGGTCCCCTGGTGCTGCAACTCCTCTCCTTCACGCTCTTGGCTGGGCTCCTTGTCCAAGTGTCCAAGGTCCCCAGCTCCATAAGTCAGGAACAATCCAGGCAAGACGCGATCTACCAGAACCTGACCCAGCTTAAAGCTGCAGTGGGTGAGCTCTCAGAGAAATCCAAGCTGCAGGAGATCTACCAGGAGCTGACCCAGCTGAAGGCTGCAGTGGGTGAGCTTCCAGAGAAATCTAAGCTGCAGGAGATCTACCAGGAGCTGACCCGGCTGAAGGCTGCAGTGGGTGAGCTTCCAGAGAAATCTAAGCTGCAGGAGATCTACCAGGAGCTGACCTGGCTGAAGGCTGCAGTGGGTGAGCTTCCAGAGAAATCTAAGATGCAGGAGATCTACCAGGAGCTGACTCGGCTGAAGGCTGCAGTGGGTGAGCTTCCAGAGAAATCTAAGCAGCAGGAGATCTACCAGGAGCTGACCCGGCTGAAGGCTGCAGTGGGTGAGCTTCCAGAGAAATCTAAGCAGCAGGAGATCTACCAGGAGCTGACCCGGCTGAAGGCTGCAGTGGGTGAGCTTCCAGAGAAATCTAAGCAGCAGGAGATCTACCAGGAGCTGACCCAGCTGAAGGCTGCAGTGGAACGCCTGTGCCACCCCTGTCCCTGGGAATGGACATTCTTCCAAGGAAACTGTTACTTCATGTCTAACTCCCAGCGGAACTGGCACGACTCCATCACCGCCTGCAAAGAAGTGGGGGCCCAGCTCGTCGTAATCAAAAGTGCTGAGGAGCAGAACTTCCTACAGCTGCAGTCTTCCAGAAGTAACCGCTTCACCTGGATGGGACTTTCAGATCTAAATCAGGAAGGCACGTGGCAATGGGTGGACGGCTCACCTCTGTTGCCCAGCTTCAAGCAGTATTGGAACAGAGGAGAGCCCAACAACGTTGGGGAGGAAGACTGCGCGGAATTTAGTGGCAATGGCTGGAACGACGACAAATGTAATCTTGCCAAATTCTGGATCTGCAAAAAGTCCGCAGCCTCCTGCTCCAGGGATGAAGAACAGTTTCTTTCTCCAGCCCCTGCCACCCCAAACCCCCCTCCTGCGTAG
ORF Protein Sequence MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T59082-Ab Anti-CD209/ CDSIGN/ CLEC4L monoclonal antibody
    Target Antigen GM-Tg-g-T59082-Ag CD209 VLP (virus-like particle)
    ORF Viral Vector pGMLP003650 Human CD209 Lentivirus plasmid
    ORF Viral Vector pGMLV000730 Human CD209 Lentivirus plasmid
    ORF Viral Vector pGMLV001037 Human CD209 Lentivirus plasmid
    ORF Viral Vector vGMLP003650 Human CD209 Lentivirus particle
    ORF Viral Vector vGMLV000730 Human CD209 Lentivirus particle
    ORF Viral Vector vGMLV001037 Human CD209 Lentivirus particle


    Target information

    Target ID GM-T59082
    Target Name CD209
    Gene ID 30835, 288375, 100462978, 100629660
    Gene Symbol and Synonyms CD209,Cd209a,CDSIGN,CLEC4L,DC-SIGN,DC-SIGN1,hDC-SIGN
    Uniprot Accession Q9NNX6
    Uniprot Entry Name CD209_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000090659
    Target Classification Not Available

    This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including leprosy and tuberculosis mycobacteria, the Ebola, hepatitis C, HIV-1 and Dengue viruses, and the SARS-CoV acute respiratory syndrome coronavirus. The protein is organized into four distinct domains: a C-terminal carbohydrate recognition domain, a flexible tandem-repeat neck domain, a transmembrane region and an N-terminal cytoplasmic domain involved in internalization. This gene is closely related in terms of both sequence and function to a neighboring gene, CLEC4M (Gene ID: 10332), also known as L-SIGN. The two genes differ in viral recognition and expression patterns, with this gene showing high expression on the surface of dendritic cells. Polymorphisms in the neck region are associated with protection from HIV-1 infection, while single nucleotide polymorphisms in the promoter of this gene are associated with differing resistance and susceptibility to and severity of infectious disease, including rs4804803, which is associated with SARS severity. [provided by RefSeq, May 2020]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.