Human FNDC4/FRCP1 ORF/cDNA clone-Lentivirus plasmid (NM_022823.3)
Cat. No.: pGMLV001286
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FNDC4/FRCP1 Lentiviral expression plasmid for FNDC4 lentivirus packaging, FNDC4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
FNDC4/FRCP1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV001286 |
Gene Name | FNDC4 |
Accession Number | NM_022823.3 |
Gene ID | 64838 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 705 bp |
Gene Alias | FRCP1 |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | Null |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCAAGCGGATGCCACAGTTCCCCCCCCAGCGGACTCCGTGGGGACATGGCTTCGCTGGTGCCCCTTTCCCCATATCTAAGCCCCACGGTCCTCCTGCTGGTCAGCTGTGACCTGGGCTTCGTGCGAGCAGACCGGCCTCCCTCTCCTGTGAATGTGACGGTCACTCACCTCAGAGCCAACTCGGCCACTGTGTCCTGGGACGTCCCAGAAGGCAACATCGTCATTGGCTACTCCATTTCCCAGCAACGGCAGAATGGCCCCGGGCAGCGTGTGATTCGGGAGGTGAACACCACCACCCGGGCCTGTGCCCTCTGGGGCCTGGCTGAAGACAGTGACTACACAGTGCAGGTCAGGAGCATCGGCCTTCGGGGAGAGAGTCCCCCAGGGCCCCGGGTGCACTTCCGAACTCTCAAGGGTTCTGACCGGCTACCTTCAAACAGTTCAAGCCCAGGTGACATCACAGTGGAAGGTCTGGATGGAGAGCGGCCACTGCAGACTGGGGAAGTGGTCATCATTGTGGTGGTGTTGCTCATGTGGGCTGCTGTAATTGGGCTGTTCTGCCGTCAGTATGACATCATCAAGGACAATGACTCCAACAACAATCCCAAGGAGAAGGGAAAGGGGCCGGAACAGAGTCCTCAGGGAAGGCCAGTGGGGACAAGACAGAAAAAGTCACCATCTATCAACACCATCGACGTTTGA |
ORF Protein Sequence | MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0448-Ab | Anti-FNDC4/ FRCP1 monoclonal antibody |
Target Antigen | GM-Tg-g-MP0448-Ag | FNDC4 VLP (virus-like particle) |
ORF Viral Vector | pGMLV001286 | Human FNDC4 Lentivirus plasmid |
ORF Viral Vector | vGMLV001286 | Human FNDC4 Lentivirus particle |
Target information
Target ID | GM-MP0448 |
Target Name | FNDC4 |
Gene ID | 64838, 64339, 702098, 100910821, 101096226, 483014, 781806, 111768134 |
Gene Symbol and Synonyms | 2810430J06Rik,6330410H20Rik,AABR07063279.1,FNDC4,Fnmp1,FRCP1 |
Uniprot Accession | Q9H6D8 |
Uniprot Entry Name | FNDC4_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Malignant neoplasm of bladder |
Gene Ensembl | ENSG00000115226 |
Target Classification | Not Available |
Involved in response to transforming growth factor beta. Predicted to be located in endoplasmic reticulum and extracellular space. Predicted to be active in extracellular region and plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.