Human FNDC4/FRCP1 ORF/cDNA clone-Lentivirus plasmid (NM_022823.3)

Cat. No.: pGMLV001286
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FNDC4/FRCP1 Lentiviral expression plasmid for FNDC4 lentivirus packaging, FNDC4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FNDC4/FRCP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $476.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001286
Gene Name FNDC4
Accession Number NM_022823.3
Gene ID 64838
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 705 bp
Gene Alias FRCP1
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCAAGCGGATGCCACAGTTCCCCCCCCAGCGGACTCCGTGGGGACATGGCTTCGCTGGTGCCCCTTTCCCCATATCTAAGCCCCACGGTCCTCCTGCTGGTCAGCTGTGACCTGGGCTTCGTGCGAGCAGACCGGCCTCCCTCTCCTGTGAATGTGACGGTCACTCACCTCAGAGCCAACTCGGCCACTGTGTCCTGGGACGTCCCAGAAGGCAACATCGTCATTGGCTACTCCATTTCCCAGCAACGGCAGAATGGCCCCGGGCAGCGTGTGATTCGGGAGGTGAACACCACCACCCGGGCCTGTGCCCTCTGGGGCCTGGCTGAAGACAGTGACTACACAGTGCAGGTCAGGAGCATCGGCCTTCGGGGAGAGAGTCCCCCAGGGCCCCGGGTGCACTTCCGAACTCTCAAGGGTTCTGACCGGCTACCTTCAAACAGTTCAAGCCCAGGTGACATCACAGTGGAAGGTCTGGATGGAGAGCGGCCACTGCAGACTGGGGAAGTGGTCATCATTGTGGTGGTGTTGCTCATGTGGGCTGCTGTAATTGGGCTGTTCTGCCGTCAGTATGACATCATCAAGGACAATGACTCCAACAACAATCCCAAGGAGAAGGGAAAGGGGCCGGAACAGAGTCCTCAGGGAAGGCCAGTGGGGACAAGACAGAAAAAGTCACCATCTATCAACACCATCGACGTTTGA
ORF Protein Sequence MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0448-Ab Anti-FNDC4/ FRCP1 monoclonal antibody
    Target Antigen GM-Tg-g-MP0448-Ag FNDC4 VLP (virus-like particle)
    ORF Viral Vector pGMLV001286 Human FNDC4 Lentivirus plasmid
    ORF Viral Vector vGMLV001286 Human FNDC4 Lentivirus particle


    Target information

    Target ID GM-MP0448
    Target Name FNDC4
    Gene ID 64838, 64339, 702098, 100910821, 101096226, 483014, 781806, 111768134
    Gene Symbol and Synonyms 2810430J06Rik,6330410H20Rik,AABR07063279.1,FNDC4,Fnmp1,FRCP1
    Uniprot Accession Q9H6D8
    Uniprot Entry Name FNDC4_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Malignant neoplasm of bladder
    Gene Ensembl ENSG00000115226
    Target Classification Not Available

    Involved in response to transforming growth factor beta. Predicted to be located in endoplasmic reticulum and extracellular space. Predicted to be active in extracellular region and plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.