Human AGR2/AG-2/AG2 ORF/cDNA clone-Lentivirus plasmid (NM_006408.4)
Cat. No.: pGMLV001303
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human AGR2/AG-2/AG2 Lentiviral expression plasmid for AGR2 lentivirus packaging, AGR2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
AG-2/AGR2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV001303 |
| Gene Name | AGR2 |
| Accession Number | NM_006408.4 |
| Gene ID | 10551 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 528 bp |
| Gene Alias | AG-2,AG2,GOB-4,HAG-2,HEL-S-116,HPC8,PDIA17,XAG-2 |
| Fluorescent Reporter | mCherry |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGAGAAAATTCCAGTGTCAGCATTCTTGCTCCTTGTGGCCCTCTCCTACACTCTGGCCAGAGATACCACAGTCAAACCTGGAGCCAAAAAGGACACAAAGGACTCTCGACCCAAACTGCCCCAGACCCTCTCCAGAGGTTGGGGTGACCAACTCATCTGGACTCAGACATATGAAGAAGCTCTATATAAATCCAAGACAAGCAACAAACCCTTGATGATTATTCATCACTTGGATGAGTGCCCACACAGTCAAGCTTTAAAGAAAGTGTTTGCTGAAAATAAAGAAATCCAGAAATTGGCAGAGCAGTTTGTCCTCCTCAATCTGGTTTATGAAACAACTGACAAACACCTTTCTCCTGATGGCCAGTATGTCCCCAGGATTATGTTTGTTGACCCATCTCTGACAGTTAGAGCCGATATCACTGGAAGATATTCAAATCGTCTCTATGCTTACGAACCTGCAGATACAGCTCTGTTGCTTGACAACATGAAGAAAGCTCTCAAGTTGCTGAAGACTGAATTGTAA |
| ORF Protein Sequence | MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T34352-Ab | Anti-AGR2/ AG-2/ AG2 functional antibody |
| Target Antigen | GM-Tg-g-T34352-Ag | AG-2/AGR2 protein |
| ORF Viral Vector | pGMLV001303 | Human AGR2 Lentivirus plasmid |
| ORF Viral Vector | pGMAD001490 | Human AGR2 Adenovirus plasmid |
| ORF Viral Vector | pGMAP000150 | Human AGR2 Adenovirus plasmid |
| ORF Viral Vector | vGMLV001303 | Human AGR2 Lentivirus particle |
| ORF Viral Vector | vGMAD001490 | Human AGR2 Adenovirus particle |
| ORF Viral Vector | vGMAP000150 | Human AGR2 Adenovirus particle |
Target information
| Target ID | GM-T34352 |
| Target Name | AG-2 |
| Gene ID | 10551, 23795, 709127, 298961, 101084694, 482333, 415112, 100053075 |
| Gene Symbol and Synonyms | AG-2,AG2,AGR2,Agr2h,GOB-4,HAG-2,HEL-S-116,HPC8,mAG-2,PDIA17,RIFTD,XAG-2 |
| Uniprot Accession | O95994 |
| Uniprot Entry Name | AGR2_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | Prostate Cancer, Malignant neoplasm of prostate |
| Gene Ensembl | ENSG00000106541 |
| Target Classification | Not Available |
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. [provided by RefSeq, Mar 2017]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


