Human AGR2/AG2/GOB-4 ORF/cDNA clone-Adenovirus particle (BC015503)
Cat. No.: vGMAP000150
Pre-made Human AGR2/AG2/GOB-4 Adenovirus for AGR2 overexpression in-vitro and in-vivo. The AGR2 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified AGR2-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
AG-2/AGR2/AG2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000150 | Human AGR2 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000150 |
| Gene Name | AGR2 |
| Accession Number | BC015503 |
| Gene ID | 10551 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 528 bp |
| Gene Alias | AG2,GOB-4,HAG-2,XAG-2 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGAGAAAATTCCAGTGTCAGCATTCTTGCTCCTTGTGGCCCTCTCCTACACTCTGGCCAGAGATACCACAGTCAAACCTGGAGCCAAAAAGGACACAAAGGACTCTCGACCCAAACTGCCCCAGACCCTCTCCAGAGGTTGGGGTGACCAACTCATCTGGACTCAGACATATGAAGAAGCTCTATATAAATCCAAGACAAGCAACAAACCCTTGATGATTATTCATCACTTGGATGAGTGCCCACACAGTCAAGCTTTAAAGAAAGTGTTTGCTGAAAATAAAGAAATCCAGAAATTGGCAGAGCAGTTTGTCCTCCTCAATCTGGTTTATGAAACAACTGACAAACACCTTTCTCCTGATGGCCAGTATGTCCCCAGGATTATGTTTGTTGACCCATCTCTGACAGTTAGAGCCGATATCACTGGAAGATATTCAAACCGTCTCTATGCTTACGAACCTGCAGATACAGCTCTGTTGCTTGACAACATGAAGAAAGCTCTCAAGTTGCTGAAGACTGAATTGTAA |
| ORF Protein Sequence | MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T34352-Ab | Anti-AGR2/ AG-2/ AG2 functional antibody |
| Target Antigen | GM-Tg-g-T34352-Ag | AG-2/AGR2 protein |
| ORF Viral Vector | pGMLV001303 | Human AGR2 Lentivirus plasmid |
| ORF Viral Vector | pGMAD001490 | Human AGR2 Adenovirus plasmid |
| ORF Viral Vector | pGMAP000150 | Human AGR2 Adenovirus plasmid |
| ORF Viral Vector | vGMLV001303 | Human AGR2 Lentivirus particle |
| ORF Viral Vector | vGMAD001490 | Human AGR2 Adenovirus particle |
| ORF Viral Vector | vGMAP000150 | Human AGR2 Adenovirus particle |
Target information
| Target ID | GM-T34352 |
| Target Name | AG-2 |
| Gene ID | 10551, 23795, 709127, 298961, 101084694, 482333, 415112, 100053075 |
| Gene Symbol and Synonyms | AG-2,AG2,AGR2,Agr2h,GOB-4,HAG-2,HEL-S-116,HPC8,mAG-2,PDIA17,RIFTD,XAG-2 |
| Uniprot Accession | O95994 |
| Uniprot Entry Name | AGR2_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | Prostate Cancer, Malignant neoplasm of prostate |
| Gene Ensembl | ENSG00000106541 |
| Target Classification | Not Available |
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. [provided by RefSeq, Mar 2017]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


