Human IL18BP/FVH/IL18BPa ORF/cDNA clone-Lentivirus plasmid (NM_001039659.2)
Cat. No.: pGMLV001571
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL18BP/FVH/IL18BPa Lentiviral expression plasmid for IL18BP lentivirus packaging, IL18BP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IL18BP/FVH products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV001571 |
| Gene Name | IL18BP |
| Accession Number | NM_001039659.2 |
| Gene ID | 10068 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 585 bp |
| Gene Alias | FVH,IL18BPa |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGACCATGAGACACAACTGGACACCAGACCTCAGCCCTTTGTGGGTCCTGCTCCTGTGTGCCCACGTCGTCACTCTCCTGGTCAGAGCCACACCTGTCTCGCAGACCACCACAGCTGCCACTGCCTCAGTTAGAAGCACAAAGGACCCCTGCCCCTCCCAGCCCCCAGTGTTCCCAGCAGCTAAGCAGTGTCCAGCATTGGAAGTGACCTGGCCAGAGGTGGAAGTGCCACTGAATGGAACGCTGAGCTTATCCTGTGTGGCCTGCAGCCGCTTCCCCAACTTCAGCATCCTCTACTGGCTGGGCAATGGTTCCTTCATTGAGCACCTCCCAGGCCGACTGTGGGAGGGGAGCACCAGCCGGGAACGTGGGAGCACAGGTACGCAGCTGTGCAAGGCCTTGGTGCTGGAGCAGCTGACCCCTGCCCTGCACAGCACCAACTTCTCCTGTGTGCTCGTGGACCCTGAACAGGTTGTCCAGCGTCACGTCGTCCTGGCCCAGCTCTGGGCTGGGCTGAGGGCAACCTTGCCCCCCACCCAAGAAGCCCTGCCCTCCAGCCACAGCAGTCCACAGCAGCAGGGTTAA |
| ORF Protein Sequence | MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1023-Ab | Anti-I18BP/ IL18BP/ IL18BPa functional antibody |
| Target Antigen | GM-Tg-g-SE1023-Ag | IL18BP protein |
| Cytokine | cks-Tg-g-GM-SE1023 | interleukin 18 binding protein (IL18BP) protein & antibody |
| ORF Viral Vector | pGMLP000015 | Human IL18BP Lentivirus plasmid |
| ORF Viral Vector | pGMLV001571 | Human IL18BP Lentivirus plasmid |
| ORF Viral Vector | vGMLP000015 | Human IL18BP Lentivirus particle |
| ORF Viral Vector | vGMLV001571 | Human IL18BP Lentivirus particle |
Target information
| Target ID | GM-SE1023 |
| Target Name | IL18BP |
| Gene ID | 10068, 16068, 100144607, 84388, 101096599, 476818, 617470, 100066161 |
| Gene Symbol and Synonyms | FVH,Igifbp,IL-18BP,IL18BP,IL18BPa,MC54L |
| Uniprot Accession | O95998 |
| Uniprot Entry Name | I18BP_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Cytokine Target |
| Disease | Malignant neoplasm of prostate |
| Gene Ensembl | ENSG00000137496 |
| Target Classification | Not Available |
The protein encoded by this gene functions as an inhibitor of the proinflammatory cytokine, IL18. It binds IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses. This protein is constitutively expressed and secreted in mononuclear cells. Elevated level of this protein is detected in the intestinal tissues of patients with Crohn's disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2011]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


