Human FNDC5/FRCP2/irisin ORF/cDNA clone-Lentivirus plasmid (NM_001171941)
Cat. No.: pGMLV001869
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FNDC5/FRCP2/irisin Lentiviral expression plasmid for FNDC5 lentivirus packaging, FNDC5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
FNDC5/FRCP2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV001869 |
| Gene Name | FNDC5 |
| Accession Number | NM_001171941 |
| Gene ID | 252995 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 462 bp |
| Gene Alias | FRCP2,irisin |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCTGCGCTTCATCCAGGAGGTGAACACCACCACCCGCTCATGTGCCCTCTGGGACCTGGAGGAGGATACGGAGTACATAGTCCACGTGCAGGCCATCTCCATTCAGGGCCAGAGCCCAGCCAGCGAGCCTGTGCTCTTCAAGACCCCGCGTGAGGCTGAGAAGATGGCCTCCAAGAACAAAGATGAGGTAACCATGAAAGAGATGGGGAGGAACCAACAGCTGCGGACAGGCGAGGTGCTGATCATCGTCGTGGTCCTGTTCATGTGGGCAGGTGTCATTGCCCTCTTCTGCCGCCAGTATGACATCATCAAGGACAATGAACCCAATAACAACAAGGAAAAAACCAAGAGTGCATCAGAAACCAGCACACCAGAGCACCAGGGCGGGGGGCTTCTCCGCAGCAAGGTGAGGGCAAGACCTGGGCCTGGGTGGGCCACCCTGTGCCTCATGCTCTGGTAA |
| ORF Protein Sequence | MLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKVRARPGPGWATLCLMLW |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0449-Ab | Anti-FNDC5/ FRCP2/ irisin monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0449-Ag | FNDC5 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000060 | Human FNDC5 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001869 | Human FNDC5 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000060 | Human FNDC5 Lentivirus particle |
| ORF Viral Vector | vGMLV001869 | Human FNDC5 Lentivirus particle |
Target information
| Target ID | GM-MP0449 |
| Target Name | FNDC5 |
| Gene ID | 252995, 384061, 710159, 260327, 101083019, 487302, 538905, 100146454 |
| Gene Symbol and Synonyms | 1500001L03Rik,FNDC5,FRCP2,irisin,PeP,Pxp |
| Uniprot Accession | Q8NAU1 |
| Uniprot Entry Name | FNDC5_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000160097 |
| Target Classification | Not Available |
This gene encodes a secreted protein that is released from muscle cells during exercise. The encoded protein may participate in the development of brown fat. Translation of the precursor protein initiates at a non-AUG start codon at a position that is conserved as an AUG start codon in other organisms. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


