Human TFPI/EPI/LACI ORF/cDNA clone-Lentivirus plasmid (NM_006287.6)

Cat. No.: pGMLV002019
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TFPI/EPI/LACI Lentiviral expression plasmid for TFPI lentivirus packaging, TFPI lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TFPI/EPI products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $528.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV002019
Gene Name TFPI
Accession Number NM_006287.6
Gene ID 7035
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 915 bp
Gene Alias EPI,LACI,TFI,TFPI1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATTTACACAATGAAGAAAGTACATGCACTTTGGGCTTCTGTATGCCTGCTGCTTAATCTTGCCCCTGCCCCTCTTAATGCTGATTCTGAGGAAGATGAAGAACACACAATTATCACAGATACGGAGTTGCCACCACTGAAACTTATGCATTCATTTTGTGCATTCAAGGCGGATGATGGCCCATGTAAAGCAATCATGAAAAGATTTTTCTTCAATATTTTCACTCGACAGTGCGAAGAATTTATATATGGGGGATGTGAAGGAAATCAGAATCGATTTGAAAGTCTGGAAGAGTGCAAAAAAATGTGTACAAGAGATAATGCAAACAGGATTATAAAGACAACATTGCAACAAGAAAAGCCAGATTTCTGCTTTTTGGAAGAAGATCCTGGAATATGTCGAGGTTATATTACCAGGTATTTTTATAACAATCAGACAAAACAGTGTGAACGTTTCAAGTATGGTGGATGCCTGGGCAATATGAACAATTTTGAGACACTGGAAGAATGCAAGAACATTTGTGAAGATGGTCCGAATGGTTTCCAGGTGGATAATTATGGAACCCAGCTCAATGCTGTGAATAACTCCCTGACTCCGCAATCAACCAAGGTTCCCAGCCTTTTTGAATTTCACGGTCCCTCATGGTGTCTCACTCCAGCAGACAGAGGATTGTGTCGTGCCAATGAGAACAGATTCTACTACAATTCAGTCATTGGGAAATGCCGCCCATTTAAGTACAGTGGATGTGGGGGAAATGAAAACAATTTTACTTCCAAACAAGAATGTCTGAGGGCATGTAAAAAAGGTTTCATCCAAAGAATATCAAAAGGAGGCCTAATTAAAACCAAAAGAAAAAGAAAGAAGCAGAGAGTGAAAATAGCATATGAAGAAATTTTTGTTAAAAATATGTGA
ORF Protein Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-118 Pre-Made Concizumab biosimilar, Whole mAb, Anti-TFPI Antibody: Anti-EPI/LACI/TFI therapeutic antibody
    Biosimilar GMP-Bios-ab-053 Pre-Made Befovacimab biosimilar, Whole mAb, Anti-TFPI Antibody: Anti-EPI/LACI/TFI therapeutic antibody
    Target Antibody GM-Tg-g-T78890-Ab Anti-TFPI1/ TFPI/ EPI monoclonal antibody
    Target Antigen GM-Tg-g-T78890-Ag TFPI VLP (virus-like particle)
    ORF Viral Vector pGMLP004933 Human TFPI Lentivirus plasmid
    ORF Viral Vector pGMLV002019 Human TFPI Lentivirus plasmid
    ORF Viral Vector vGMLP004933 Human TFPI Lentivirus particle
    ORF Viral Vector vGMLV002019 Human TFPI Lentivirus particle


    Target information

    Target ID GM-T78890
    Target Name TFPI
    Gene ID 7035, 21788, 613026, 29436, 101098813, 403921, 508763, 100068873
    Gene Symbol and Synonyms A630013F22Rik,EPI,LACI,TFI,TFPI,TFPI1
    Uniprot Accession P10646
    Uniprot Entry Name TFPI1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index
    Disease Lung Cancer
    Gene Ensembl ENSG00000003436
    Target Classification Not Available

    This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization. [provided by RefSeq, Jul 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.