Human MTPN/GCDP/V-1 ORF/cDNA clone-Lentivirus plasmid (NM_145808)

Cat. No.: pGMLV002327
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MTPN/GCDP/V-1 Lentiviral expression plasmid for MTPN lentivirus packaging, MTPN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MTPN/GCDP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV002327
Gene Name MTPN
Accession Number NM_145808
Gene ID 136319
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 357 bp
Gene Alias GCDP,V-1
Fluorescent Reporter null
Mammalian Cell Selection Neomycin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGCGACAAGGAGTTCATGTGGGCCCTGAAAAACGGAGACTTGGATGAGGTGAAAGACTATGTGGCCAAGGGAGAAGATGTCAACCGGACACTAGAAGGTGGAAGGAAACCTCTTCATTATGCAGCAGATTGTGGGCAGCTTGAAATCCTGGAATTTCTGCTGCTGAAAGGAGCAGATATTAATGCTCCAGATAAACATCATATTACTCCTCTTCTGTCTGCTGTCTATGAGGGTCATGTTTCCTGTGTGAAATTGCTTCTGTCAAAGGGTGCTGATAAGACTGTGAAAGGCCCAGATGGACTGACCGCCTTTGAAGCCACTGACAACCAGGCAATCAAAGCTCTTCTCCAGTGA
ORF Protein Sequence MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2612-Ab Anti-MTPN monoclonal antibody
    Target Antigen GM-Tg-g-IP2612-Ag MTPN protein
    ORF Viral Vector pGMLP003390 Human MTPN Lentivirus plasmid
    ORF Viral Vector pGMLV002327 Human MTPN Lentivirus plasmid
    ORF Viral Vector vGMLP003390 Human MTPN Lentivirus particle
    ORF Viral Vector vGMLV002327 Human MTPN Lentivirus particle


    Target information

    Target ID GM-IP2612
    Target Name MTPN
    Gene ID 136319, 14489, 708941, 79215, 101097881, 403487, 541099, 100064934
    Gene Symbol and Synonyms 5033418D15Rik,GCDP,MTPN,V-1,V1
    Uniprot Accession P58546
    Uniprot Entry Name MTPN_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000105887
    Target Classification Not Available

    The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.