Human MTPN/GCDP/V-1 ORF/cDNA clone-Lentivirus plasmid (NM_145808)
Cat. No.: pGMLV002327
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MTPN/GCDP/V-1 Lentiviral expression plasmid for MTPN lentivirus packaging, MTPN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
MTPN/GCDP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV002327 |
| Gene Name | MTPN |
| Accession Number | NM_145808 |
| Gene ID | 136319 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 357 bp |
| Gene Alias | GCDP,V-1 |
| Fluorescent Reporter | null |
| Mammalian Cell Selection | Neomycin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTGCGACAAGGAGTTCATGTGGGCCCTGAAAAACGGAGACTTGGATGAGGTGAAAGACTATGTGGCCAAGGGAGAAGATGTCAACCGGACACTAGAAGGTGGAAGGAAACCTCTTCATTATGCAGCAGATTGTGGGCAGCTTGAAATCCTGGAATTTCTGCTGCTGAAAGGAGCAGATATTAATGCTCCAGATAAACATCATATTACTCCTCTTCTGTCTGCTGTCTATGAGGGTCATGTTTCCTGTGTGAAATTGCTTCTGTCAAAGGGTGCTGATAAGACTGTGAAAGGCCCAGATGGACTGACCGCCTTTGAAGCCACTGACAACCAGGCAATCAAAGCTCTTCTCCAGTGA |
| ORF Protein Sequence | MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP2612-Ab | Anti-MTPN monoclonal antibody |
| Target Antigen | GM-Tg-g-IP2612-Ag | MTPN protein |
| ORF Viral Vector | pGMLP003390 | Human MTPN Lentivirus plasmid |
| ORF Viral Vector | pGMLV002327 | Human MTPN Lentivirus plasmid |
| ORF Viral Vector | vGMLP003390 | Human MTPN Lentivirus particle |
| ORF Viral Vector | vGMLV002327 | Human MTPN Lentivirus particle |
Target information
| Target ID | GM-IP2612 |
| Target Name | MTPN |
| Gene ID | 136319, 14489, 708941, 79215, 101097881, 403487, 541099, 100064934 |
| Gene Symbol and Synonyms | 5033418D15Rik,GCDP,MTPN,V-1,V1 |
| Uniprot Accession | P58546 |
| Uniprot Entry Name | MTPN_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000105887 |
| Target Classification | Not Available |
The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


