Human IL36B/FIL1/FIL1-(ETA) ORF/cDNA clone-Adenovirus particle (NM_173178)

Cat. No.: vGMAP-IL-123

Pre-made Human IL36B/FIL1/FIL1-(ETA) Adenovirus for IL36B overexpression in-vitro and in-vivo. The IL36B adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IL36B-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to IL36B/FIL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP-IL-123 Human IL36B Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP-IL-123
Gene Name IL36B
Accession Number NM_173178
Gene ID 27177
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 474 bp
Gene Alias FIL1,FIL1-(ETA),FIL1H,FILI-(ETA),IL-1F8,IL-1H2,IL1-ETA,IL1F8,IL1H2
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAACCCACAACGGGAGGCAGCACCCAAATCCTATGCTATTCGTGATTCTCGACAGATGGTGTGGGTCCTGAGTGGAAATTCTTTAATAGCAGCTCCTCTTAGCCGCAGCATTAAGCCTGTCACTCTTCATTTAATAGCCTGTAGAGACACAGAATTCAGTGACAAGGAAAAGGGTAATATGGTTTACCTGGGAATCAAGGGAAAAGATCTCTGTCTCTTCTGTGCAGAAATTCAGGGCAAGCCTACTTTGCAGCTTAAGGAAAAAAATATCATGGACCTGTATGTGGAGAAGAAAGCACAGAAGCCCTTTCTCTTTTTCCACAATAAAGAAGGCTCCACTTCTGTCTTTCAGTCAGTCTCTTACCCTGGCTGGTTCATAGCCACCTCCACCACATCAGGACAGCCCATCTTTCTCACCAAGGAGAGAGGCATAACTAATAACACTAACTTCTACTTAGATTCTGTGGAATAA
ORF Protein Sequence MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1030-Ab Anti-IL36B/ FIL1/ FIL1-(ETA) functional antibody
    Target Antigen GM-Tg-g-SE1030-Ag IL36B protein
    Cytokine cks-Tg-g-GM-SE1030 interleukin 36, beta (IL36B) protein & antibody
    ORF Viral Vector pGMLP-IL-040 Human IL36B Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-123 Human IL36B Adenovirus plasmid
    ORF Viral Vector vGMLP-IL-040 Human IL36B Lentivirus particle
    ORF Viral Vector vGMAP-IL-123 Human IL36B Adenovirus particle


    Target information

    Target ID GM-SE1030
    Target Name IL36B
    Gene ID 27177, 69677, 701300, 362076, 483068, 100297786, 100065096
    Gene Symbol and Synonyms 2310043N20Rik,FIL1,FIL1-(ETA),FIL1H,FILI-(ETA),If36b,IL-1F8,IL-1H2,IL1-ETA,IL1F8,IL1H2,IL36B
    Uniprot Accession Q9NZH7
    Uniprot Entry Name IL36B_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Not Available
    Gene Ensembl ENSG00000136696
    Target Classification Not Available

    The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.