Human CDK7/CAK/CAK1 ORF/cDNA clone-Adenovirus particle (NM_001799)

Cat. No.: vGMAP-SPh-151

Pre-made Human CDK7/CAK/CAK1 Adenovirus for CDK7 overexpression in-vitro and in-vivo. The CDK7 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CDK7-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CDK7/CAK products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP-SPh-151 Human CDK7 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP-SPh-151
Gene Name CDK7
Accession Number NM_001799
Gene ID 1022
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 1041 bp
Gene Alias CAK,CAK1,CDKN7,HCAK,MO15,p39MO15,STK1
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCTGGACGTGAAGTCTCGGGCAAAGCGTTATGAGAAGCTGGACTTCCTTGGGGAGGGACAGTTTGCCACCGTTTACAAGGCCAGAGATAAGAACACCAACCAAATTGTCGCCATTAAGAAAATCAAACTTGGACATAGATCAGAAGCTAAAGATGGTATAAATAGAACCGCCTTAAGAGAGATAAAATTATTACAGGAGCTAAGTCATCCAAATATAATTGGTCTCCTTGATGCTTTTGGACATAAATCTAATATTAGCCTTGTCTTTGATTTTATGGAAACTGATCTAGAGGTTATAATAAAGGATAATAGTCTTGTGCTGACACCATCACACATCAAAGCCTACATGTTGATGACTCTTCAAGGATTAGAATATTTACATCAACATTGGATCCTACATAGGGATCTGAAACCAAACAACTTGTTGCTAGATGAAAATGGAGTTCTAAAACTGGCAGATTTTGGCCTGGCCAAATCTTTTGGGAGCCCCAATAGAGCTTATACACATCAGGTTGTAACCAGGTGGTATCGGGCCCCCGAGTTACTATTTGGAGCTAGGATGTATGGTGTAGGTGTGGACATGTGGGCTGTTGGCTGTATATTAGCAGAGTTACTTCTAAGGGTTCCTTTTTTGCCAGGAGATTCAGACCTTGATCAGCTAACAAGAATATTTGAAACTTTGGGCACACCAACTGAGGAACAGTGGCCGGACATGTGTAGTCTTCCAGATTATGTGACATTTAAGAGTTTCCCTGGAATACCTTTGCATCACATCTTCAGTGCAGCAGGAGACGACTTACTAGATCTCATACAAGGCTTATTCTTATTTAATCCATGTGCTCGAATTACGGCCACACAGGCACTGAAAATGAAGTATTTCAGTAATCGGCCAGGGCCAACACCTGGATGTCAGCTGCCAAGACCAAACTGTCCAGTGGAAACCTTAAAGGAGCAATCAAATCCAGCTTTGGCAATAAAAAGGAAAAGAACAGAGGCCTTAGAACAAGGAGGATTGCCCAAGAAACTAATTTTTTAA
ORF Protein Sequence MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T58449-Ab Anti-CDK7 monoclonal antibody
    Target Antigen GM-Tg-g-T58449-Ag CDK7 protein
    ORF Viral Vector pGMLP001367 Human CDK7 Lentivirus plasmid
    ORF Viral Vector pGMLP005448 Human CDK7 Lentivirus plasmid
    ORF Viral Vector pGMLP-SPh-011 Human CDK7 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-151 Human CDK7 Adenovirus plasmid
    ORF Viral Vector vGMLP001367 Human CDK7 Lentivirus particle
    ORF Viral Vector vGMLP005448 Human CDK7 Lentivirus particle
    ORF Viral Vector vGMLP-SPh-011 Human CDK7 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-151 Human CDK7 Adenovirus particle


    Target information

    Target ID GM-T58449
    Target Name CDK7
    Gene ID 1022, 12572, 699871, 171150, 101086781, 608441, 515462, 100049964
    Gene Symbol and Synonyms C230069N13,CAK,CAK1,CDK7,CDKN7,Crk4,HCAK,MO15,P39 Mo15,p39MO15,STK1
    Uniprot Accession P50613
    Uniprot Entry Name CDK7_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Prostate Cancer
    Gene Ensembl ENSG00000134058
    Target Classification Checkpoint-Immuno Oncology, Kinase

    The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.