Human CDK7/CAK/CAK1 ORF/cDNA clone-Adenovirus particle (NM_001799)
Cat. No.: vGMAP-SPh-151
Pre-made Human CDK7/CAK/CAK1 Adenovirus for CDK7 overexpression in-vitro and in-vivo. The CDK7 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CDK7-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
CDK7/CAK products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAP-SPh-151 | Human CDK7 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAP-SPh-151 |
Gene Name | CDK7 |
Accession Number | NM_001799 |
Gene ID | 1022 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 1041 bp |
Gene Alias | CAK,CAK1,CDKN7,HCAK,MO15,p39MO15,STK1 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTCTGGACGTGAAGTCTCGGGCAAAGCGTTATGAGAAGCTGGACTTCCTTGGGGAGGGACAGTTTGCCACCGTTTACAAGGCCAGAGATAAGAACACCAACCAAATTGTCGCCATTAAGAAAATCAAACTTGGACATAGATCAGAAGCTAAAGATGGTATAAATAGAACCGCCTTAAGAGAGATAAAATTATTACAGGAGCTAAGTCATCCAAATATAATTGGTCTCCTTGATGCTTTTGGACATAAATCTAATATTAGCCTTGTCTTTGATTTTATGGAAACTGATCTAGAGGTTATAATAAAGGATAATAGTCTTGTGCTGACACCATCACACATCAAAGCCTACATGTTGATGACTCTTCAAGGATTAGAATATTTACATCAACATTGGATCCTACATAGGGATCTGAAACCAAACAACTTGTTGCTAGATGAAAATGGAGTTCTAAAACTGGCAGATTTTGGCCTGGCCAAATCTTTTGGGAGCCCCAATAGAGCTTATACACATCAGGTTGTAACCAGGTGGTATCGGGCCCCCGAGTTACTATTTGGAGCTAGGATGTATGGTGTAGGTGTGGACATGTGGGCTGTTGGCTGTATATTAGCAGAGTTACTTCTAAGGGTTCCTTTTTTGCCAGGAGATTCAGACCTTGATCAGCTAACAAGAATATTTGAAACTTTGGGCACACCAACTGAGGAACAGTGGCCGGACATGTGTAGTCTTCCAGATTATGTGACATTTAAGAGTTTCCCTGGAATACCTTTGCATCACATCTTCAGTGCAGCAGGAGACGACTTACTAGATCTCATACAAGGCTTATTCTTATTTAATCCATGTGCTCGAATTACGGCCACACAGGCACTGAAAATGAAGTATTTCAGTAATCGGCCAGGGCCAACACCTGGATGTCAGCTGCCAAGACCAAACTGTCCAGTGGAAACCTTAAAGGAGCAATCAAATCCAGCTTTGGCAATAAAAAGGAAAAGAACAGAGGCCTTAGAACAAGGAGGATTGCCCAAGAAACTAATTTTTTAA |
ORF Protein Sequence | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T58449-Ab | Anti-CDK7 monoclonal antibody |
Target Antigen | GM-Tg-g-T58449-Ag | CDK7 protein |
ORF Viral Vector | pGMLP001367 | Human CDK7 Lentivirus plasmid |
ORF Viral Vector | pGMLP005448 | Human CDK7 Lentivirus plasmid |
ORF Viral Vector | pGMLP-SPh-011 | Human CDK7 Lentivirus plasmid |
ORF Viral Vector | pGMAP-SPh-151 | Human CDK7 Adenovirus plasmid |
ORF Viral Vector | vGMLP001367 | Human CDK7 Lentivirus particle |
ORF Viral Vector | vGMLP005448 | Human CDK7 Lentivirus particle |
ORF Viral Vector | vGMLP-SPh-011 | Human CDK7 Lentivirus particle |
ORF Viral Vector | vGMAP-SPh-151 | Human CDK7 Adenovirus particle |
Target information
Target ID | GM-T58449 |
Target Name | CDK7 |
Gene ID | 1022, 12572, 699871, 171150, 101086781, 608441, 515462, 100049964 |
Gene Symbol and Synonyms | C230069N13,CAK,CAK1,CDK7,CDKN7,Crk4,HCAK,MO15,P39 Mo15,p39MO15,STK1 |
Uniprot Accession | P50613 |
Uniprot Entry Name | CDK7_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target, Immuno-oncology Target |
Disease | Prostate Cancer |
Gene Ensembl | ENSG00000134058 |
Target Classification | Checkpoint-Immuno Oncology, Kinase |
The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.