Human CDK5/PSSALRE ORF/cDNA clone-Adenovirus particle (BC005115)

Cat. No.: vGMAP000048

Pre-made Human CDK5/PSSALRE Adenovirus for CDK5 overexpression in-vitro and in-vivo. The CDK5 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CDK5-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CDK5/PSSALRE products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000048 Human CDK5 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000048
Gene Name CDK5
Accession Number BC005115
Gene ID 1020
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 879 bp
Gene Alias PSSALRE
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGCAGAAATACGAGAAACTGGAAAAGATTGGGGAAGGCACCTACGGAACTGTGTTCAAGGCCAAAAACCGGGAGACTCATGAGATCGTGGCTCTGAAACGGGTGAGGCTGGATGACGATGATGAGGGTGTGCCGAGTTCCGCCCTCCGGGAGATCTGCCTACTCAAGGAGCTGAAGCACAAGAACATCGTCAGGCTTCATGACGTCCTGCACAGCGACAAGAAGCTGACTTTGGTTTTTGAATTCTGTGACCAGGACCTGAAGAAGTATTTTGACAGTTGCAATGGTGACCTCGATCCTGAGATTGTAAAGTCATTCCTCTTCCAGCTACTAAAAGGGCTGGGATTCTGTCATAGCCGCAATGTGCTACACAGGGACCTGAAGCCCCAGAACCTGCTAATAAACAGGAATGGGGAGCTGAAATTGGCTGATTTTGGCCTGGCTCGAGCCTTTGGGATTCCCGTCCGCTGTTACTCAGCTGAGGTGGTCACACTGTGGTACCGCCCACCGGATGTCCTCTTTGGGGCCAAGCTGTACTCCACGTCCATCGACATGTGGTCAGCCGGCTGCATCTTTGCAGAGCTGGCCAATGCTGGGCGGCCTCTTTTTCCCGGCAATGATGTCGATGACCAGTTGAAGAGGATCTTCCGACTGCTGGGGACGCCCACCGAGGAGCAGTGGCCCTCTATGACCAAGCTGCCAGACTATAAGCCCTATCCGATGTACCCGGCCACAACATCCCTGGTGAACGTCGTGCCCAAACTCAATGCCACAGGGAGGGATCTGCTGCAGAACCTTCTGAAGTGTAACCCTGTCCAGCGTATCTCAGCAGAAGAGGCCCTGCAGCACCCCTACTTCTCCGACTTCTGTCCGCCCTAG
ORF Protein Sequence MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T20973-Ab Anti-CDK5/ LIS7/ PSSALRE monoclonal antibody
    Target Antigen GM-Tg-g-T20973-Ag CDK5 VLP (virus-like particle)
    ORF Viral Vector pGMLP005383 Human CDK5 Lentivirus plasmid
    ORF Viral Vector pGMAP000019 Human CDK5 Adenovirus plasmid
    ORF Viral Vector pGMAP000048 Human CDK5 Adenovirus plasmid
    ORF Viral Vector vGMLP005383 Human CDK5 Lentivirus particle
    ORF Viral Vector vGMAP000019 Human CDK5 Adenovirus particle
    ORF Viral Vector vGMAP000048 Human CDK5 Adenovirus particle


    Target information

    Target ID GM-T20973
    Target Name CDK5
    Gene ID 1020, 12568, 714445, 140908, 101097226, 475537, 281066, 100063442
    Gene Symbol and Synonyms CDK5,Crk6,LIS7,PSSALRE
    Uniprot Accession Q00535
    Uniprot Entry Name CDK5_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Lung Cancer
    Gene Ensembl ENSG00000164885
    Target Classification Kinase

    This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.